BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0509 (780 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 137 8e-33 SB_11799| Best HMM Match : Keratin_B2 (HMM E-Value=0.69) 32 0.45 SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) 30 1.8 SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) 29 4.2 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 28 7.4 SB_7540| Best HMM Match : Transgly_assoc (HMM E-Value=0.46) 28 7.4 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 7.4 SB_32083| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_27097| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_16437| Best HMM Match : RNA_pol (HMM E-Value=2e-15) 28 9.8 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 137 bits (332), Expect = 8e-33 Identities = 62/85 (72%), Positives = 74/85 (87%) Frame = +1 Query: 256 LDNNPALEKLLPHIKGNVGFVFTRGDLVEVRDKLLENKVQAPARPGAIAPLSVVIPAHNT 435 L+NNP LEKLLPHIKGN+GFVFT+ DL +VR ++ENKV APA+ G IAP+ V +PA NT Sbjct: 51 LENNPDLEKLLPHIKGNIGFVFTKEDLADVRKIIMENKVAAPAKAGVIAPIDVFVPAGNT 110 Query: 436 GLGPEKTSFFQALSIPTKISKGTIE 510 GLGPEKTSFFQAL+IPTKI++GTIE Sbjct: 111 GLGPEKTSFFQALAIPTKIARGTIE 135 Score = 76.2 bits (179), Expect = 3e-14 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +2 Query: 107 QLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIK 250 Q LDEYPK F+VG DNVGS+QMQ IR SLRG VLMGKNTM+RKAI+ Sbjct: 1 QYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQGEVLMGKNTMIRKAIR 48 >SB_11799| Best HMM Match : Keratin_B2 (HMM E-Value=0.69) Length = 430 Score = 32.3 bits (70), Expect = 0.45 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 1/105 (0%) Frame = +2 Query: 128 KCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDPWTTIQPSRNCCHTSRAT 307 +C + V S +QQ +S+R + + ++ ++ +I+P+R C HTS Sbjct: 51 RCCQHTSSKVLSAYVQQGVVSIRPARCCQHTSSKVLSTYVQQGVVSIRPARCCQHTSSKV 110 Query: 308 LAS-CSPAETSLRSVTNCWRTKSKLQLVLVPLPHCQSSFPPTTPA 439 L++ S+R C T SK+ V + Q PA Sbjct: 111 LSTYVQLGVVSIRPARCCQHTSSKVLSAYVQQAYVQQGVVSIRPA 155 Score = 31.5 bits (68), Expect = 0.79 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 1/92 (1%) Frame = +2 Query: 107 QLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDPWTTIQPSRNC 286 ++L +C + V S +QQ +S+R + + ++ ++ +I+P+R C Sbjct: 204 KVLSRPARCCQHTSSKVLSAYVQQGVVSIRPARCCQHTSSKVLSAYVQQGVVSIRPARCC 263 Query: 287 CHTSRATLAS-CSPAETSLRSVTNCWRTKSKL 379 HTS L++ S+R C T SK+ Sbjct: 264 QHTSSKVLSTYVQSGVVSIRPARCCQHTSSKV 295 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = +2 Query: 128 KCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDPWTTIQPSRNCCHTSRAT 307 +C + V S +QQ +S+R + + ++ ++ +I+P+R C HTS Sbjct: 320 RCCQHTSSKVLSAYVQQGVVSIRPARCCQHTSSKVLSAYVQQGVVSIRPARCCQHTSSKV 379 Query: 308 L-ASCSPAETSLRSVTNCWRTKSKL 379 L A S+R C T SK+ Sbjct: 380 LSAYVQQGVVSIRPARCCQHTSSKV 404 Score = 30.3 bits (65), Expect = 1.8 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +2 Query: 146 ADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDPWTTIQPSRNCCHTSRATL-ASCS 322 + V S +QQ +S+R + + ++ ++ +I+P+R C HTS L A Sbjct: 301 SSKVLSAYVQQGVVSIRPARCCQHTSSKVLSAYVQQGVVSIRPARCCQHTSSKVLSAYVQ 360 Query: 323 PAETSLRSVTNCWRTKSKL 379 S+R C T SK+ Sbjct: 361 QGVVSIRPARCCQHTSSKV 379 Score = 30.3 bits (65), Expect = 1.8 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = +2 Query: 128 KCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDPWTTIQPSRNCCHTSRAT 307 +C + V S +QQ +S+R + + ++ ++ +I+P+R C HTS Sbjct: 345 RCCQHTSSKVLSAYVQQGVVSIRPARCCQHTSSKVLSAYVQQGVVSIRPARCCQHTSSKV 404 Query: 308 L-ASCSPAETSLRSVTNCWRTKSKL 379 L A S+R C T SK+ Sbjct: 405 LSAYVQQGVVSIRPARCCEHTSSKV 429 Score = 29.5 bits (63), Expect = 3.2 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +2 Query: 173 QQIRISLRGSSIVLMGKNTMMRKAIKDPWTTIQPSRNCCHTSRATLAS-CSPAETSLRSV 349 QQ +S+R + + ++ ++ +I+P+R C HTS L++ S+R Sbjct: 41 QQGVVSIRPARCCQHTSSKVLSAYVQQGVVSIRPARCCQHTSSKVLSTYVQQGVVSIRPA 100 Query: 350 TNCWRTKSKLQLVLVPL 400 C T SK+ V L Sbjct: 101 RCCQHTSSKVLSTYVQL 117 >SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) Length = 870 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 474 KSLEERGLLWTEAGVVGGNDD*QWG 400 K+LEERGLL+ +GV GG + ++G Sbjct: 160 KALEERGLLFVGSGVSGGEEGARYG 184 >SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) Length = 672 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 428 WAGMTTDNGAMAPGRAGAWTLFSNSL 351 W+ T D PGRA AW+L+S +L Sbjct: 594 WSIATLDGKDQPPGRAWAWSLWSTTL 619 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 365 FSNSLSRTSTRSPRVNTKPTLPLMCGNSFSRAGLLSR 255 FS+S + T KP +CG SFS++G LSR Sbjct: 464 FSDSSTLTKRLRTHTGEKPYQCRICGMSFSQSGNLSR 500 >SB_7540| Best HMM Match : Transgly_assoc (HMM E-Value=0.46) Length = 320 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 4/67 (5%) Frame = +3 Query: 549 VGASEATLLNMLNISPFSYGLVVKQVYD---SGTIFAP-EILDIKPEDLRAKFQAGVANV 716 + S + + +L +SP YG+ + +G +F IL + PE + + A VA Sbjct: 82 IAGSSSVYIGLLGLSPAQYGITFAAIVSALIAGALFTQRRILQLGPEKIVSIGAALVATG 141 Query: 717 AALSLAI 737 A +LAI Sbjct: 142 ALTTLAI 148 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 121 VPKMFHRGCR*RGLATDAADPYLAT-WLQYRAHGKK 225 VPKMFH RG+ T+A P + T +L+ R G++ Sbjct: 3856 VPKMFHGNRDNRGIKTNAIFPTIITRYLRIRPMGRR 3891 >SB_32083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/73 (26%), Positives = 28/73 (38%) Frame = +2 Query: 149 DNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDPWTTIQPSRNCCHTSRATLASCSPA 328 D +G QQ + ++ L L+G + R+ + T SR C + SCS Sbjct: 1 DGIGQQQPKLYKLVLPNFGFQLIGYPGIYRQTGRGEEVTWHGSRTCTLHRKLAGVSCSCC 60 Query: 329 ETSLRSVTNCWRT 367 SL W T Sbjct: 61 GNSLLHTHFTWTT 73 >SB_27097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +1 Query: 592 LHSHMVLLLSRYMILELFLHLKFWTSNQKIS 684 L S +++++ RY+ + LH + W S +K+S Sbjct: 145 LLSMLLMMVDRYIAIAWGLHYRIWKSQRKVS 175 >SB_16437| Best HMM Match : RNA_pol (HMM E-Value=2e-15) Length = 944 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -1 Query: 306 VALDVWQQFLEGWIVVQGSLMALRIIVFFPMSTILEPRSE 187 + L + + L GW QG+LM++R++ +S LEP E Sbjct: 218 LGLSAYNKILHGW-AEQGNLMSVRVMHKLILSEDLEPDME 256 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,596,555 Number of Sequences: 59808 Number of extensions: 593983 Number of successful extensions: 1598 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1589 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -