BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0508 (549 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 30 0.058 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 3.8 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 6.6 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 29.9 bits (64), Expect = 0.058 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = -1 Query: 117 CGLS*ILCPPIAVHDGGSRLT---RRSYS-SGFTHLDSTTPIG 1 CG S I PP A+H GGSR T +R+YS S L+S G Sbjct: 874 CG-SGIASPPAAIHGGGSRTTTVLKRTYSNSSINSLNSLDNYG 915 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 3.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 86 MGGQRIQESPHGYEMEG*PFRWC 154 MG I SP G +M F WC Sbjct: 83 MGVMPIMRSPKGVDMPRTTFTWC 105 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.0 bits (47), Expect = 6.6 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Frame = -2 Query: 269 RSLSFVL-NELYTD-AF-ADGRVGLLSFYTNFLEDDALCVRCTTERVS-LPF 126 RS++ ++ NE + D A+ AD R LLS +FLED + ER LPF Sbjct: 301 RSIATLMSNEHFHDIAYTADDREELLSAIDDFLEDSIVLPPSKWERQGLLPF 352 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,775 Number of Sequences: 2352 Number of extensions: 12353 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -