BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0508 (549 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70684-7|CAA94601.1| 143|Caenorhabditis elegans Hypothetical pr... 127 5e-30 Z92838-1|CAB07406.1| 157|Caenorhabditis elegans Hypothetical pr... 36 0.025 AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical ... 28 5.1 AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical ... 28 5.1 Z81128-8|CAB03402.1| 811|Caenorhabditis elegans Hypothetical pr... 27 6.7 U55374-8|AAB36868.3| 1538|Caenorhabditis elegans Uncoordinated p... 27 8.9 U55374-6|AAM69092.1| 1926|Caenorhabditis elegans Uncoordinated p... 27 8.9 U55374-5|AAP82640.2| 2027|Caenorhabditis elegans Uncoordinated p... 27 8.9 AY264781-1|AAP13107.1| 2027|Caenorhabditis elegans high voltage ... 27 8.9 >Z70684-7|CAA94601.1| 143|Caenorhabditis elegans Hypothetical protein F28D1.7 protein. Length = 143 Score = 127 bits (307), Expect = 5e-30 Identities = 55/65 (84%), Positives = 62/65 (95%) Frame = +3 Query: 69 HRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLI 248 HR+EQRW DK +KKAH+GT+WK+NPFGGASHAKGIVLEK+GVEAKQPNSAIRKCVRVQLI Sbjct: 16 HRQEQRWNDKRYKKAHIGTRWKSNPFGGASHAKGIVLEKIGVEAKQPNSAIRKCVRVQLI 75 Query: 249 KNERK 263 KN +K Sbjct: 76 KNGKK 80 Score = 121 bits (292), Expect = 3e-28 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = +2 Query: 257 KKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKK 436 KK+TAFVP DGCLN +EENDEVLV+GFGR GHAVGDIPGVRFK+VKVAN SL+AL+K KK Sbjct: 79 KKITAFVPNDGCLNFVEENDEVLVSGFGRSGHAVGDIPGVRFKIVKVANTSLIALFKGKK 138 Query: 437 ERPRS 451 ERPRS Sbjct: 139 ERPRS 143 >Z92838-1|CAB07406.1| 157|Caenorhabditis elegans Hypothetical protein T03D8.2 protein. Length = 157 Score = 35.5 bits (78), Expect = 0.025 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +3 Query: 150 GASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL 245 G SH KGIVL+ V K+PNS RKC V+L Sbjct: 72 GYSHYKGIVLKTVIRHPKKPNSGNRKCAIVRL 103 >AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical protein Y59A8B.9 protein. Length = 187 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 387 TLKRTPGMSPTA*PLRPNPATSTSS 313 T RTP +P A P RP P+ S+++ Sbjct: 38 TTMRTPAATPAAPPTRPTPSRSSAA 62 >AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical protein Y59A8B.7 protein. Length = 316 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 387 TLKRTPGMSPTA*PLRPNPATSTSS 313 T RTP +P A P RP P+ S+++ Sbjct: 167 TTMRTPAATPAAPPTRPTPSRSSAA 191 >Z81128-8|CAB03402.1| 811|Caenorhabditis elegans Hypothetical protein T23D8.9a protein. Length = 811 Score = 27.5 bits (58), Expect = 6.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 266 TAFVPRDGCLNHIEEN 313 T FVP+DG LN I+EN Sbjct: 653 TPFVPKDGVLNVIDEN 668 >U55374-8|AAB36868.3| 1538|Caenorhabditis elegans Uncoordinated protein 2, isoform a protein. Length = 1538 Score = 27.1 bits (57), Expect = 8.9 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = -3 Query: 208 GCLASTPTFSRTMPFA*DAPPKGLAFHF-VPMWAFLNSL---SAHRCSRRWFTS---YAP 50 GC S F + + K F++ V FLN+ S H +WFT YA Sbjct: 366 GCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAE 425 Query: 49 FVFLGVY 29 FVFLG++ Sbjct: 426 FVFLGIF 432 >U55374-6|AAM69092.1| 1926|Caenorhabditis elegans Uncoordinated protein 2, isoform c protein. Length = 1926 Score = 27.1 bits (57), Expect = 8.9 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = -3 Query: 208 GCLASTPTFSRTMPFA*DAPPKGLAFHF-VPMWAFLNSL---SAHRCSRRWFTS---YAP 50 GC S F + + K F++ V FLN+ S H +WFT YA Sbjct: 366 GCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAE 425 Query: 49 FVFLGVY 29 FVFLG++ Sbjct: 426 FVFLGIF 432 >U55374-5|AAP82640.2| 2027|Caenorhabditis elegans Uncoordinated protein 2, isoform b protein. Length = 2027 Score = 27.1 bits (57), Expect = 8.9 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = -3 Query: 208 GCLASTPTFSRTMPFA*DAPPKGLAFHF-VPMWAFLNSL---SAHRCSRRWFTS---YAP 50 GC S F + + K F++ V FLN+ S H +WFT YA Sbjct: 500 GCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAE 559 Query: 49 FVFLGVY 29 FVFLG++ Sbjct: 560 FVFLGIF 566 >AY264781-1|AAP13107.1| 2027|Caenorhabditis elegans high voltage activated calciumchannel alpha-1 subunit protein. Length = 2027 Score = 27.1 bits (57), Expect = 8.9 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = -3 Query: 208 GCLASTPTFSRTMPFA*DAPPKGLAFHF-VPMWAFLNSL---SAHRCSRRWFTS---YAP 50 GC S F + + K F++ V FLN+ S H +WFT YA Sbjct: 500 GCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAE 559 Query: 49 FVFLGVY 29 FVFLG++ Sbjct: 560 FVFLGIF 566 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,368,033 Number of Sequences: 27780 Number of extensions: 288844 Number of successful extensions: 675 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -