BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0506 (558 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 83 1e-16 SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) 52 2e-07 SB_29416| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) 36 0.022 SB_58880| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 34 0.091 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_25198| Best HMM Match : Tropomyosin (HMM E-Value=1.5e-08) 31 0.64 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 31 0.64 SB_18605| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_36579| Best HMM Match : C1_1 (HMM E-Value=0.00011) 31 0.84 SB_59312| Best HMM Match : Tropomodulin (HMM E-Value=0.11) 30 1.1 SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 30 1.5 SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 30 1.5 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 30 1.5 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) 30 1.5 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_59346| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_38212| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_35915| Best HMM Match : DUF593 (HMM E-Value=0.12) 29 1.9 SB_33424| Best HMM Match : zf-B_box (HMM E-Value=2.2e-18) 29 1.9 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_4107| Best HMM Match : M (HMM E-Value=8e-22) 29 1.9 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 29 1.9 SB_38638| Best HMM Match : zf-B_box (HMM E-Value=6.8e-18) 29 1.9 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 1.9 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 29 1.9 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 29 2.6 SB_20574| Best HMM Match : Extensin_2 (HMM E-Value=0.25) 29 2.6 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 29 2.6 SB_9150| Best HMM Match : PspA_IM30 (HMM E-Value=0.98) 29 2.6 SB_1965| Best HMM Match : TEP1_N (HMM E-Value=1.5) 29 2.6 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 29 3.4 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 29 3.4 SB_32747| Best HMM Match : zf-B_box (HMM E-Value=7.4e-18) 29 3.4 SB_2860| Best HMM Match : IncA (HMM E-Value=0.41) 29 3.4 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 28 4.5 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 28 4.5 SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) 28 4.5 SB_38632| Best HMM Match : bZIP_1 (HMM E-Value=1.1) 28 4.5 SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) 28 4.5 SB_45286| Best HMM Match : GRIP (HMM E-Value=3.6e-08) 28 4.5 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_1401| Best HMM Match : zf-B_box (HMM E-Value=1.1e-09) 28 4.5 SB_1091| Best HMM Match : Cupin_4 (HMM E-Value=0) 28 4.5 SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 28 5.9 SB_46597| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_36664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 28 5.9 SB_36560| Best HMM Match : Tropomyosin (HMM E-Value=9.6e-07) 28 5.9 SB_19644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_54597| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 27 7.9 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 27 7.9 SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_48805| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-32) 27 7.9 SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) 27 7.9 SB_28019| Best HMM Match : KNOX2 (HMM E-Value=0.24) 27 7.9 SB_27687| Best HMM Match : zf-B_box (HMM E-Value=6.7e-10) 27 7.9 SB_22572| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_884| Best HMM Match : KNOX2 (HMM E-Value=0.24) 27 7.9 SB_43739| Best HMM Match : bZIP_1 (HMM E-Value=0.59) 27 7.9 SB_41737| Best HMM Match : zf-B_box (HMM E-Value=2.3e-10) 27 7.9 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_34433| Best HMM Match : zf-B_box (HMM E-Value=1.8e-19) 27 7.9 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 27 7.9 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 27 7.9 SB_15549| Best HMM Match : ADH_zinc_N (HMM E-Value=9.4e-13) 27 7.9 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 83.0 bits (196), Expect = 1e-16 Identities = 39/84 (46%), Positives = 60/84 (71%) Frame = +2 Query: 2 KKYDEVARKLAMVEADLXXXXXXXXXXXXKIVELEEELRVVGNNLKSLEVSEEKANQREE 181 K+Y+E++ +L +E +L ++ ELEEE+ +VGNNL+SLE+SE KA++RE+ Sbjct: 118 KQYEEISERLQELENELEEAEQKADAAEARVKELEEEVTLVGNNLRSLEISEGKASERED 177 Query: 182 EYKNQIKTLTTRLKEAEARAEFAE 253 Y+NQI+ L T+L++AE RAE AE Sbjct: 178 TYENQIRELETKLQDAEERAEKAE 201 >SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) Length = 495 Score = 52.4 bits (120), Expect = 2e-07 Identities = 27/90 (30%), Positives = 48/90 (53%) Frame = +2 Query: 14 EVARKLAMVEADLXXXXXXXXXXXXKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKN 193 EV R+L + ++L ++ ELE L+V G +++ L +SEEK +E+E+++ Sbjct: 375 EVQRRLTLTTSELHKIRARQREKEEEVRELENRLKVGGRSIQQLVISEEKYCDKEDEFRH 434 Query: 194 QIKTLTTRLKEAEARAEFAELPCRNCKRRS 283 +I+ L L RAE +E C +R + Sbjct: 435 RIRLLKANLAATILRAEESERRCMRLEREN 464 >SB_29416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 43.6 bits (98), Expect = 1e-04 Identities = 33/114 (28%), Positives = 49/114 (42%), Gaps = 2/114 (1%) Frame = +2 Query: 2 KKYD--EVARKLAMVEADLXXXXXXXXXXXXKIVELEEELRVVGNNLKSLEVSEEKANQR 175 K++D E+ +K+ + E +L I LE + N+ SLE + A+Q Sbjct: 117 KEHDNTEINQKIVVTETELSKVNERLERALETIERLEATIEEESTNMASLEQKDTDASQW 176 Query: 176 EEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRRSIGLKTNLSPKRRNTRTSE 337 E E + +I L +LKE RAE AE C +R T + R R E Sbjct: 177 EIEVEEKIGFLNEQLKEVLVRAEDAERRCGPLERLLDEQSTQIDDFRNKKRDVE 230 >SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) Length = 1127 Score = 35.9 bits (79), Expect = 0.022 Identities = 18/50 (36%), Positives = 32/50 (64%) Frame = +2 Query: 107 EELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAEL 256 ++L + G LK L +S+E A++RE + K++++ + RLK AE +E L Sbjct: 455 QKLEIEGKYLKELNLSKESASERENKLKSELEETSKRLK-AEHTSELETL 503 >SB_58880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1098 Score = 34.7 bits (76), Expect = 0.052 Identities = 16/49 (32%), Positives = 31/49 (63%) Frame = +2 Query: 89 KIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEA 235 +I +E+EL + NNLK E EKA Q E + +++++ ++++EA + Sbjct: 318 EIKSIEKELPDLKNNLKKAEADLEKAVQGEAKSSQELRSIRSKVEEARS 366 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 33.9 bits (74), Expect = 0.091 Identities = 18/65 (27%), Positives = 34/65 (52%) Frame = +2 Query: 101 LEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRR 280 L+ E+ + LEV+ E +R ++ K++I L ++KEA+ A+ E ++ + Sbjct: 2480 LKREIVTYQEKISRLEVNYENIKERNKDLKDEIAELMIQVKEAKTAAKSNEQDKKDLENE 2539 Query: 281 SIGLK 295 I LK Sbjct: 2540 IISLK 2544 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 31.5 bits (68), Expect = 0.48 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +2 Query: 98 ELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAE 253 + E+ L GN LE ++ QRE E + QI L +L EAE++ A+ Sbjct: 1719 DYEKLLAKSGNKDDLLENLRKRNKQRENELQKQIADLQRKLNEAESKIRTAD 1770 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 4/55 (7%) Frame = +2 Query: 92 IVELEEELRVVGNNLKSLEVSEEKANQR----EEEYKNQIKTLTTRLKEAEARAE 244 I++L+EEL NN + +EKAN ++++N I L +LKEAEA E Sbjct: 191 ILKLKEEL----NNAEMRASQQEKANSSLGKLVKKHENTIADLMQQLKEAEADVE 241 >SB_25198| Best HMM Match : Tropomyosin (HMM E-Value=1.5e-08) Length = 277 Score = 31.1 bits (67), Expect = 0.64 Identities = 21/83 (25%), Positives = 37/83 (44%) Frame = +2 Query: 5 KYDEVARKLAMVEADLXXXXXXXXXXXXKIVELEEELRVVGNNLKSLEVSEEKANQREEE 184 K EV K+ +V+ +L L + L+ LEV + A++RE + Sbjct: 125 KLAEVELKIKVVQGELEKAVERGDRAEMMCEHLMNDFTGTSEVLRDLEVKDAAASEREID 184 Query: 185 YKNQIKTLTTRLKEAEARAEFAE 253 +++I+ + LK+ R E AE Sbjct: 185 NEDKIEFIQENLKQMVYRYEEAE 207 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 31.1 bits (67), Expect = 0.64 Identities = 15/45 (33%), Positives = 28/45 (62%) Frame = +2 Query: 101 LEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEA 235 L L+ + + + E+S +++E K++I+TL TRL++AEA Sbjct: 748 LGNHLQTIESLKQKSELSSSSLRFQDDERKHEIETLKTRLQKAEA 792 Score = 31.1 bits (67), Expect = 0.64 Identities = 18/55 (32%), Positives = 31/55 (56%) Frame = +2 Query: 89 KIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAE 253 +I EL EE R+ N ++++SE +A Q E++++I LKE + + AE Sbjct: 921 RIEELLEEKRL---NYDAMQLSEREATQVRREFESKINLTEKLLKETTEKLDVAE 972 >SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 31.1 bits (67), Expect = 0.64 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = +2 Query: 92 IVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNC 271 + E+E + +++ EV EKA + + + Q++ T +EAEA E E P + Sbjct: 1020 VEEVEAPIEEAAASVEEAEVPIEKAETQPVDTEGQVENAETSFEEAEAADEETEEPVKEA 1079 Query: 272 K 274 + Sbjct: 1080 E 1080 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +2 Query: 143 LEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRRS 283 +E S E+A EEE K ++ + ++EA A E AE+P + ++ Sbjct: 1142 VESSVEEAEAPEEEVKAPVEEVEAPVEEAVASVEEAEVPIEEAETQA 1188 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +2 Query: 146 EVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCK 274 EV EKA EE + + + ++EAEA A AE P K Sbjct: 747 EVLVEKAEASVEEAEVPVDEVEASVEEAEAPAHEAEAPVEEAK 789 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 31.1 bits (67), Expect = 0.64 Identities = 23/83 (27%), Positives = 41/83 (49%) Frame = +2 Query: 95 VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCK 274 VELE+EL VV + + +E ++ K+ Q E K + T+L+ R E C + Sbjct: 2587 VELEDELTVVQHRITEIE-NDNKSCQHE---KASLAVEITKLRNQNVRFEKQREDCER-E 2641 Query: 275 RRSIGLKTNLSPKRRNTRTSETI 343 + + + +L + NT++ E I Sbjct: 2642 KEHLRQQVSLMRSKGNTQSEELI 2664 Score = 27.9 bits (59), Expect = 5.9 Identities = 20/81 (24%), Positives = 37/81 (45%) Frame = +2 Query: 101 LEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRR 280 ++EEL N+L LE+ + + + K Q+ RL A+AR E N +++ Sbjct: 1273 IKEELVQANNDLADLEIEHDTVQKDYDSLKKQLADANERL--AKAREE-----NMNLQQQ 1325 Query: 281 SIGLKTNLSPKRRNTRTSETI 343 + LK L + R + + + Sbjct: 1326 IVELKMRLESEERESAEKDNL 1346 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 89 KIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAE 232 KI LEE L+ N+ LEV+ + ++E + T TR E E Sbjct: 1157 KIRSLEENLKNSQTNVNKLEVTISNIGKEQQERERASATHDTRYYEIE 1204 >SB_18605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1400 Score = 31.1 bits (67), Expect = 0.64 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +1 Query: 256 SVQKLQKEVDRLEDELVAEKEKYKDIGDDLD 348 +V+K Q E+ +LEDEL ++ + KD D+LD Sbjct: 354 AVKKAQLELAKLEDELRRKRNQLKDAVDELD 384 >SB_36579| Best HMM Match : C1_1 (HMM E-Value=0.00011) Length = 633 Score = 30.7 bits (66), Expect = 0.84 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 241 RVRRASVQKLQKEVDRLEDELVAEKEKY 324 +V A ++K +KE +L EL AE+EKY Sbjct: 331 KVSSADLRKKEKECKKLHQELAAEREKY 358 >SB_59312| Best HMM Match : Tropomodulin (HMM E-Value=0.11) Length = 561 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/48 (29%), Positives = 28/48 (58%) Frame = +2 Query: 164 ANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRRSIGLKTNLS 307 AN ++ YK ++ L E+++ AE+ +NCK +++ L+ N+S Sbjct: 189 ANALKKNYKLRVLELEGDSFESDSVKAIAEMLSQNCKLKNLSLRLNIS 236 >SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1894 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = +2 Query: 89 KIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 KI + ++L+ + +N++S S +EE +N+ K L ++ + R E +N Sbjct: 196 KIDQNIKDLQKLSDNIESTLKSVSYLIDEDEEKENEAKALFGPMQAPKEREEIKSELDKN 255 Query: 269 CKRRSIGLKTN 301 K +I KTN Sbjct: 256 LKTHAIACKTN 266 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = +2 Query: 101 LEEELRVVGNNLKSLEVS-EEKANQREEEYKN---QIKTLTTRLKEAE 232 LE ELR V L+ +E ++ ++E E K+ Q+K L RLK+AE Sbjct: 564 LENELREVKQKLEGVEKKYQQYREEKEPELKSLRDQVKNLGERLKDAE 611 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/75 (21%), Positives = 39/75 (52%), Gaps = 1/75 (1%) Frame = +2 Query: 98 ELEEELR-VVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCK 274 +LEE+L+ ++ +N L + + +E+E ++ L +L+++E AE+ E + Sbjct: 845 KLEEQLQEILSSNQSMLSELQSTLDSKEQENGEYLRKLDEQLEQSEKHAEYLEGRIAQLQ 904 Query: 275 RRSIGLKTNLSPKRR 319 + +++ L K + Sbjct: 905 QNLFLIRSTLQGKEK 919 >SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 808 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/89 (21%), Positives = 42/89 (47%), Gaps = 5/89 (5%) Frame = +2 Query: 2 KKYDEVARKLAMVEADLXXXXXXXXXXXXKIVELEEELRVVGN----NLKSLEVSEEKAN 169 ++YDE ++ +++ KI EL+ +L + N + LE +++ + Sbjct: 645 RQYDE---RIHLLQTSFEELQLQSTKQQSKISELQSQLSAITRENEINKRQLETMKQQLD 701 Query: 170 QREEEYKNQIKTLTTRL-KEAEARAEFAE 253 Q+E EY+N++ L E + ++E + Sbjct: 702 QKESEYRNEVNRSRLELDSERKTQSELRD 730 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E ++E++ Q +TL+ RL A + EFAE CR+ Sbjct: 385 ESACQKQEKQLTAQRETLSMRLASARSSLEFAERMCRD 422 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E ++E++ Q +TL+ RL A + EFAE CR+ Sbjct: 170 ESACQKQEKQLTAQRETLSMRLASARSSLEFAERMCRD 207 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Frame = +2 Query: 101 LEEELRVVGN---NLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNC 271 LE+EL V NLK+ ++K N+ + + + K +KE + +A+ A C Sbjct: 1045 LEQELIVKQREILNLKTALAKQQKENEEQSKIADNYKAELAHMKEIKQKADSAPQVFEKC 1104 Query: 272 KRRSIG 289 + R G Sbjct: 1105 ENRDKG 1110 >SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) Length = 1495 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -2 Query: 161 SPLRLPEISGCYQRHGAP--PQAQRFWIRRTRHAPRRAPSQPQPW 33 SPLR P Y RHG P P +W R RR P W Sbjct: 1108 SPLRRPPAE--YDRHGRPLPPPPDDYWRREAWERERRKSPPPLDW 1150 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E ++E++ Q +TL+ RL A + EFAE CR+ Sbjct: 265 ESACQKQEKQLTAQRETLSMRLASARSSLEFAERMCRD 302 >SB_59346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 684 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = -1 Query: 444 LNRGLMVLPGHSDFGSLYNGSLFLENELYEGGIQIVSDVLVFLLFGDKFVFKPI 283 + R L +P H F +YN E Y I + ++F+L G+ PI Sbjct: 389 MGRTLHTVPAHKTFKMVYNKRRGANKEPYVASIFVAVIAMLFILIGNLNALAPI 442 >SB_38212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1892 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/49 (32%), Positives = 30/49 (61%) Frame = +2 Query: 92 IVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEAR 238 I L+ EL NNL++++ ++ N + +EYK++ L +LKE +A+ Sbjct: 121 IDRLKRELSDSDNNLQAVQ---DELNAKFQEYKDRENELKVKLKELQAK 166 >SB_35915| Best HMM Match : DUF593 (HMM E-Value=0.12) Length = 371 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 95 VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLT 211 + LEEELR + + L+ + S A Q E Q++T T Sbjct: 332 LRLEEELRALSDRLRCAQTSCAVAEQERSELHEQLQTTT 370 >SB_33424| Best HMM Match : zf-B_box (HMM E-Value=2.2e-18) Length = 270 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q +TL+ RL A + EFAE CR Sbjct: 204 ESACQKQEKQLTAQRETLSMRLASARSSLEFAERMCR 240 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 29.5 bits (63), Expect = 1.9 Identities = 22/69 (31%), Positives = 27/69 (39%) Frame = +1 Query: 142 SGSLRGEGQPTRRGVQKSDQNPHHPSEGG*STCRVRRASVQKLQKEVDRLEDELVAEKEK 321 SGS TRR S + H P G R + +K RLE E A+ K Sbjct: 264 SGSKHRSKDRTRRDSGDSHERQHRPQRSGSDASNDSRRGTHRSRKHKHRLESEKKAKNVK 323 Query: 322 YKDIGDDLD 348 K I +LD Sbjct: 324 -KIIIHELD 331 >SB_4107| Best HMM Match : M (HMM E-Value=8e-22) Length = 2039 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 92 IVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAE 253 I +L++++ LE S + EE K Q+++L LKE EAR + E Sbjct: 69 IQKLQQKVLQYKRKCGELESSMNEKTTAEENAKRQLQSLNDSLKEKEARLKETE 122 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E + E++ Q +TL+ RL A + EFAE CR+ Sbjct: 265 ESACQKHEKQLTAQRETLSMRLASARSSLEFAERMCRD 302 >SB_38638| Best HMM Match : zf-B_box (HMM E-Value=6.8e-18) Length = 364 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q +TL+ RL A + EFAE CR Sbjct: 240 ESACQKQEKQLTAQRETLSMRLASARSSLEFAERMCR 276 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 253 ASVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 366 +S +QKE + L+D+L+ + K+ ++ +LD A EL Sbjct: 497 SSYLAVQKEKEELQDDLLTAQAKFNELQAELDKAHREL 534 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 101 LEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 244 LEE+L+ + +L EK Q + Y+N+I + L +AE R + Sbjct: 1504 LEEQLQSMKVSLVLSRDDSEKIKQDQSRYQNEILGIKEALSDAETRVQ 1551 Score = 28.3 bits (60), Expect = 4.5 Identities = 28/116 (24%), Positives = 54/116 (46%), Gaps = 5/116 (4%) Frame = +2 Query: 5 KYDEVARKLAMVEADLXXXXXXXXXXXXKIVELEEELRV-----VGNNLKSLEVSEEKAN 169 K D + R+ +++D+ K + +E+ R+ + ++ LE S +KAN Sbjct: 2134 KVDALEREKKKLQSDVNAAQAKIAQAQAKQIAEQEKARLKHDGALQKRVQELESSLQKAN 2193 Query: 170 QREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRRSIGLKTNLSPKRRNTRTSE 337 E +N++ + TRL + E +FA+ C R L+ ++ K +N + SE Sbjct: 2194 HDHEGAENELTLVRTRLVKME--QDFAD-----CNRAKESLEYDV--KLKNNQVSE 2240 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 98 ELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAE 232 ELE+EL ++SLE S +KAN++ E ++ L + E E Sbjct: 673 ELEKELAGSKLKIQSLENSLDKANEKTSEAEHNNGRLRKTISELE 717 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E + E++ Q +TL+ RL A + EFAE CR+ Sbjct: 751 ESACQKHEKQLTAQRETLSMRLASARSSLEFAERMCRD 788 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E + E++ Q +TL+ RL A + EFAE CR+ Sbjct: 267 ESACQKHEKQLTAQRETLSMRLASARSSLEFAERMCRD 304 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/64 (25%), Positives = 33/64 (51%) Frame = +2 Query: 89 KIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 +I ELEEE+R + L + S+ + +++ E +I +L R+ + +A+ + Sbjct: 1728 RIQELEEEIRDLMLKLGTSRESDNQGDKQNSEMSARINSLEKRITTLQGQAQDKDEEIAQ 1787 Query: 269 CKRR 280 KR+ Sbjct: 1788 LKRK 1791 >SB_20574| Best HMM Match : Extensin_2 (HMM E-Value=0.25) Length = 1508 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/57 (22%), Positives = 29/57 (50%) Frame = +1 Query: 160 EGQPTRRGVQKSDQNPHHPSEGG*STCRVRRASVQKLQKEVDRLEDELVAEKEKYKD 330 E P+ +GV+ D+ P E T +R+ + K ++ ++ ++ K++Y+D Sbjct: 1011 EKSPSGKGVRGKDERKDSPKEARKKTSPEKRSQGARSSKGDEKRVNKKISPKDRYRD 1067 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/57 (22%), Positives = 29/57 (50%) Frame = +1 Query: 160 EGQPTRRGVQKSDQNPHHPSEGG*STCRVRRASVQKLQKEVDRLEDELVAEKEKYKD 330 E P+ +GV+ D+ P E T +R+ + K ++ ++ ++ K++Y+D Sbjct: 370 EKSPSGKGVRGKDERKDSPKEARKKTSPEKRSQGARSSKGDEKRVNKKISPKDRYRD 426 >SB_9150| Best HMM Match : PspA_IM30 (HMM E-Value=0.98) Length = 242 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +2 Query: 137 KSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRRSI 286 K +E E+A EEE + ++ + ++EA A E AE+P + + + Sbjct: 33 KKVEAPIEEAEAPEEEVEATVEEVEAPMEEAAASVEEAEVPIEKAETQPV 82 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/79 (22%), Positives = 33/79 (41%) Frame = +2 Query: 38 VEADLXXXXXXXXXXXXKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTR 217 VEA + + E+E + +++ EV EKA + + + ++ T Sbjct: 35 VEAPIEEAEAPEEEVEATVEEVEAPMEEAAASVEEAEVPIEKAETQPVDTEGPVENAETS 94 Query: 218 LKEAEARAEFAELPCRNCK 274 +EAEA E E P + + Sbjct: 95 FEEAEAADEETEEPVKEAE 113 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 143 LEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRRS 283 +E S E+A EEE + ++ + ++EA A E AE+P + ++ Sbjct: 153 VESSVEEAEAPEEEVEAPVEEVEAPVEEAVASVEEAEVPIEEAETQA 199 >SB_1965| Best HMM Match : TEP1_N (HMM E-Value=1.5) Length = 144 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q +TL+ RL A + EFAE CR Sbjct: 10 ESACQKQEKQLTAQGETLSMRLASARSSLEFAERMCR 46 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E + E+ Q +TL+ RL A + EFAE CR+ Sbjct: 260 ESACQKHEKRLTAQRETLSMRLASARSSLEFAERMCRD 297 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 6/63 (9%) Frame = -2 Query: 182 PLRVGWPSPLRLPEISGCYQRHGAP-PQAQRFWIRRT---RHAPRRAPSQPQPW--PAYE 21 PLRV WP+ P+ SG Q P P A + + + R APS+ P+ P+ Sbjct: 92 PLRVSWPANKNKPQPSGFSQEQSRPSPFASQEHNQTSPFARTMDDNAPSKSSPFVGPSSN 151 Query: 20 QPH 12 PH Sbjct: 152 TPH 154 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 28.7 bits (61), Expect = 3.4 Identities = 16/71 (22%), Positives = 37/71 (52%) Frame = +2 Query: 92 IVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNC 271 + LE+E++ LK +V++++ ++ K ++ +L+EAEA+ + C+N Sbjct: 515 VKSLEDEIKKEKEQLKKNKVAQDEQGKK---LKMEVSMTRQKLQEAEAKIRSLQEECKNL 571 Query: 272 KRRSIGLKTNL 304 + + T+L Sbjct: 572 ESQLNMANTDL 582 >SB_32747| Best HMM Match : zf-B_box (HMM E-Value=7.4e-18) Length = 330 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E + E+ Q +TL+ RL A + EFAE CR+ Sbjct: 235 ESACQKHEKRLTAQRETLSMRLASARSSLEFAERMCRD 272 >SB_2860| Best HMM Match : IncA (HMM E-Value=0.41) Length = 417 Score = 28.7 bits (61), Expect = 3.4 Identities = 16/81 (19%), Positives = 42/81 (51%) Frame = +2 Query: 2 KKYDEVARKLAMVEADLXXXXXXXXXXXXKIVELEEELRVVGNNLKSLEVSEEKANQREE 181 ++Y ++ KL ADL K++ L+EEL+ ++ + + +E A + +E Sbjct: 121 EEYSQLEEKLKQSMADLEKRERLLSDNEAKVMRLKEELQ--RDHERKMTELKEAARRMKE 178 Query: 182 EYKNQIKTLTTRLKEAEARAE 244 + +Q++ +++++ E + + Sbjct: 179 DCAHQVEMERSKVRDLEQQKQ 199 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 101 LEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAEL 256 LEEE R+ L+ LE +E+ EE+ + + L +E E R + ++ Sbjct: 1231 LEEERRLEEERLRQLEEEDEQRRLEEEQIREAEEELRRLQEEREYREQMRKI 1282 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E + +++ Q +TL+ RL A + EFAE CR+ Sbjct: 266 ESACQKHDKQLTAQRETLSMRLASARSSLEFAERMCRD 303 >SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) Length = 2322 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = +1 Query: 259 VQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELILKE 378 VQK E+ + ED+++ E++ + D+ +D + + +L E Sbjct: 1093 VQKQMVELQKFEDDMLKEEDSFDDLQKKMDESKAKHLLPE 1132 >SB_38632| Best HMM Match : bZIP_1 (HMM E-Value=1.1) Length = 178 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E + +++ Q +TL+ RL A + EFAE CR+ Sbjct: 10 ESACQKHDKQLTAQRETLSMRLASARSSLEFAERMCRD 47 >SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) Length = 1001 Score = 28.3 bits (60), Expect = 4.5 Identities = 10/48 (20%), Positives = 26/48 (54%) Frame = +2 Query: 89 KIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAE 232 ++ L ++ + ++ LE+++ K +Y+ ++ LT ++KE E Sbjct: 643 ELAALTTDIEIKQKLIEELEIAQNKIQTMRSQYEEKLVLLTHKIKETE 690 >SB_45286| Best HMM Match : GRIP (HMM E-Value=3.6e-08) Length = 800 Score = 28.3 bits (60), Expect = 4.5 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +2 Query: 104 EEELRVVGNNLKS-LEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAE 253 +EEL +++K LE S+ + +Y+N I L LKE + R E AE Sbjct: 265 KEELEQQLDDMKDMLESSKHFPESKARDYENCISQLRKELKELKERLEKAE 315 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 28.3 bits (60), Expect = 4.5 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 1/80 (1%) Frame = +2 Query: 101 LEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE-FAELPCRNCKR 277 L E++ ++ + + SLE K + EEY N++K L + ++ E + + ++ CR + Sbjct: 1634 LVEDVSMLEHKVSSLEEENLKFRRVLEEYANEVKQLHSEKEDLEKKTKLLSDEMCRLANK 1693 Query: 278 RSIGLKTNLSPKRRNTRTSE 337 G +T L R T T E Sbjct: 1694 E--GHQTTLLEGYR-TETEE 1710 >SB_1401| Best HMM Match : zf-B_box (HMM E-Value=1.1e-09) Length = 327 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E + +++ Q +TL+ RL A + EFAE CR+ Sbjct: 128 ESACQKHDKQLTAQRETLSMRLASARSSLEFAERMCRD 165 >SB_1091| Best HMM Match : Cupin_4 (HMM E-Value=0) Length = 584 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 137 KSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAE 253 K E SEE+ + EEE K++ KT T + K+ + +E E Sbjct: 492 KKKEESEEEEEKSEEEKKSKKKTKTKKGKKEKQESESEE 530 >SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 999 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -2 Query: 122 RHGAPPQA--QRFWIRRTRHAPRRAPSQPQP 36 RH PP QR W+ +RH P Q QP Sbjct: 942 RHAPPPPTLTQRAWVPGSRHTADCIPGQVQP 972 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRN 268 E ++E++ Q + L+ RL A + EFAE CR+ Sbjct: 266 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCRD 303 >SB_46597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 244 VRRASVQKLQKEVDRLEDELVAEKEKYKDI 333 V+ S++ LQ + LE+E+ + EK+KD+ Sbjct: 141 VKADSIKGLQNKFPELEEEVAKDVEKFKDL 170 >SB_36664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 27.9 bits (59), Expect = 5.9 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = +2 Query: 89 KIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 244 K+ +EE GN LK + SE++ Q E +YK +K R+ +A+A E Sbjct: 158 KLAVNDEEEDDNGNFLKVRQKSEDEKKQEEVDYKEWLKGEKKRI-DAQAAKE 208 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 27.9 bits (59), Expect = 5.9 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +2 Query: 98 ELEEELRVVGNNLKSLEVSE--EKANQREEEYKNQIKTLTTRLKEAEARAEFAEL 256 E EE LRV + + + E QR E+ + ++K RLK+ RAE E+ Sbjct: 418 EEEERLRVEAERQREEDERQRAEDERQRAEDERQRVKHEMQRLKDERRRAEEDEI 472 >SB_36560| Best HMM Match : Tropomyosin (HMM E-Value=9.6e-07) Length = 245 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 268 LQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 366 L+K+ DRL +ELV +K++ + +L+ A +L Sbjct: 207 LEKQKDRLYNELVRQKKRVAFLSRELEDALADL 239 >SB_19644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -2 Query: 122 RHGAPPQA--QRFWIRRTRHAPRRAPSQPQP 36 RH PP QR W+ +RH P Q QP Sbjct: 53 RHAPPPPTLTQRAWVPGSRHTADCIPGQVQP 83 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 266 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 302 >SB_54597| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 755 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 204 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 240 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 27.5 bits (58), Expect = 7.9 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 2/82 (2%) Frame = +2 Query: 98 ELEEELRVVGNNLKSLEVSE--EKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNC 271 +LE+EL G + K E E EK + E + Q K + KE+ + E E C++ Sbjct: 449 QLEDELTNQGKS-KEQEAQEHSEKYEALKNEMQQQGKEWLKQDKESHKQIEEREKECKSL 507 Query: 272 KRRSIGLKTNLSPKRRNTRTSE 337 + L+ NLS K+ +R E Sbjct: 508 RDEVRKLRDNLS-KQDLSRNDE 528 >SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1958 Score = 27.5 bits (58), Expect = 7.9 Identities = 19/82 (23%), Positives = 36/82 (43%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRRSIGLKTNLSPKRRNTRTS 334 ++K R++ K+ + +T + E + P R R ++ +K R +T+ Sbjct: 12 KDKERHRKDACKSFSEHITAA-RYGEKELSTTQAPKR-VARSNVTVKAGPQEARESTKKK 69 Query: 335 ETIWIPPS*SSFSRNKLPLYKD 400 + WI ++FSR PL D Sbjct: 70 KPEWIAEICAAFSRESAPLDSD 91 >SB_48805| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-32) Length = 427 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 3 RNTMRLLVSWPWLRLTWSA 59 R RL++ PWLRL WSA Sbjct: 382 RPIRRLVLRLPWLRLLWSA 400 >SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) Length = 160 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 56 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 92 >SB_28019| Best HMM Match : KNOX2 (HMM E-Value=0.24) Length = 318 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 73 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 109 >SB_27687| Best HMM Match : zf-B_box (HMM E-Value=6.7e-10) Length = 237 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 116 ESACQKQEKQLTAQRENLSMRLANARSSLEFAERMCR 152 >SB_22572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 10 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 46 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 266 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 302 >SB_884| Best HMM Match : KNOX2 (HMM E-Value=0.24) Length = 233 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 45 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 81 >SB_43739| Best HMM Match : bZIP_1 (HMM E-Value=0.59) Length = 114 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 10 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 46 >SB_41737| Best HMM Match : zf-B_box (HMM E-Value=2.3e-10) Length = 511 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 116 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 152 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 271 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 307 >SB_34433| Best HMM Match : zf-B_box (HMM E-Value=1.8e-19) Length = 272 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E + E++ + +TL+ RL A + EFAE CR Sbjct: 204 ESACQKHEKQLTARRETLSMRLASARSSLEFAERMCR 240 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 155 EEKANQREEEYKNQIKTLTTRLKEAEARAEFAELPCR 265 E ++E++ Q + L+ RL A + EFAE CR Sbjct: 266 ESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCR 302 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 247 RRASVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTA 354 ++ V L++++ ++E E V K+ + DDLDTA Sbjct: 2607 KQNEVDDLREKLSQIEKEHVLSKDSNYSLQDDLDTA 2642 >SB_15549| Best HMM Match : ADH_zinc_N (HMM E-Value=9.4e-13) Length = 562 Score = 27.5 bits (58), Expect = 7.9 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 161 KANQREEEYKNQIKTLTTRLKEAEARAEFAELPCRNCKRRSI 286 KA Q+ + KN K + + +KE E E E P N +RR++ Sbjct: 350 KAMQKMHDRKNIGKMVLSPMKEPEPEPEPVEPPKDNTRRRAL 391 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,176,443 Number of Sequences: 59808 Number of extensions: 295706 Number of successful extensions: 1468 Number of sequences better than 10.0: 78 Number of HSP's better than 10.0 without gapping: 1207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1457 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -