BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0503 (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) 31 0.83 SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) 28 5.8 SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0) 28 5.8 SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_28525| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) 28 7.7 >SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 44.8 bits (101), Expect = 6e-05 Identities = 15/27 (55%), Positives = 22/27 (81%) Frame = +2 Query: 269 MIPHKTERGKNALRRLRTYDGCPPPFD 349 MIPHKT++G A+ R++ +DG PPP+D Sbjct: 1 MIPHKTKKGTEAMNRMKVFDGVPPPYD 27 >SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) Length = 1459 Score = 31.1 bits (67), Expect = 0.83 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 37 SMAVVICWAVWRQSSPRSFSKGTKLLWFAANKSTSLATSLG 159 SM+V +C ++W + P F +L+W+ N S++ SLG Sbjct: 265 SMSVSLCQSIWYHTHPSVFVSLGQLIWY--NTHPSVSVSLG 303 >SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) Length = 624 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = +2 Query: 401 PGRNYCHVGRLSHEIGWKYRDVVRKLEDKRKGKAVKELPMKRNLRGSP 544 PG+ C VG+L + W + + R L + A P + +P Sbjct: 535 PGKQLCLVGQLGYRGRWSFSVIDRPLHTRELAAAFTRTPAAKQRANNP 582 >SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 621 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -3 Query: 253 HRILDGALKWKGPRAGFTLHLLRRNDISLSLFLKKLPEMLICSQRTTT 110 H + AL+W+G R FTL + + + LS + K + + C ++T Sbjct: 530 HEVWYQALRWRGERVYFTLIMPWMSRVPLSQPIPKRSDRVSCGALSST 577 >SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.9 bits (59), Expect = 7.7 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 12/57 (21%) Frame = +3 Query: 33 VIDGRGHLLGRLAAVIAKVLL------------EGNKVVVVRCEQINISGNFFRNKL 167 +IDGR + GRLA I ++L G+ VVV+ + I +SG + NKL Sbjct: 20 LIDGRDQICGRLAGYIGQILQGKTKPIYHHAEDVGDYVVVINTKHIVLSGTKWDNKL 76 >SB_105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2982 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = -2 Query: 275 GSCLLQSP*NLRWSSKMERSTSRIHVAPL 189 GS + Q+P L W++++ RST ++++PL Sbjct: 1713 GSLMEQNP-ALEWNTQLWRSTQEVYISPL 1740 >SB_28525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = -2 Query: 275 GSCLLQSP*NLRWSSKMERSTSRIHVAPL 189 GS + Q+P L W++++ RST ++++PL Sbjct: 385 GSLMEQNP-ALEWNTQLWRSTQEVYISPL 412 >SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) Length = 225 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -3 Query: 214 RAGFTLHLLRRNDISLSLFLKKLPEMLICSQRTTTTL 104 R G+ + + ++ ++ LFL PE++ R TT + Sbjct: 131 RGGYNCSVCKTSEAAMELFLNNQPEVIFIDMRDTTPI 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,697,458 Number of Sequences: 59808 Number of extensions: 464209 Number of successful extensions: 2027 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2024 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -