BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0502 (602 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. 27 0.62 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 24 3.3 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 7.6 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 23 7.6 >AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. Length = 133 Score = 26.6 bits (56), Expect = 0.62 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = +2 Query: 290 QRRALRLYRPRKLGQLSTHQPGSCLAGSVRTTSRS---DSNQLEDTDIITSSTYGDANF 457 +R L+ YRP+ LS + +C AG+ R D +E D I DA F Sbjct: 3 KRSKLQRYRPQMRDYLSPPKTTACTAGNKRCCRHPLLVDFRDIEGFDFIIQPKIFDAGF 61 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 24.2 bits (50), Expect = 3.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 325 VGATQYASAWILSGGLSQNNVTVRFQSARGYGYYYL 432 V A Q+ I + G NNVT+ +SA G +YL Sbjct: 177 VMALQWVRQNIAAFGGDPNNVTIFGESAGGVAVHYL 212 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 23.0 bits (47), Expect = 7.6 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 356 SCLAGSVRTTSRSDSNQLEDTDIITSSTYGDANF 457 SCL+ + + +R D + + D ++ +STY F Sbjct: 184 SCLSFAYKCVNRYDLSVVADPNLPVTSTYTSNRF 217 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 23.0 bits (47), Expect = 7.6 Identities = 8/32 (25%), Positives = 15/32 (46%) Frame = +2 Query: 92 WQMNTILVFALVVLAATNAAILPSSTRANLIV 187 W+ ILV+ + TN+ + P + I+ Sbjct: 63 WESRAILVYLVDKYGRTNSRLYPKDAKTRAII 94 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 580,049 Number of Sequences: 2352 Number of extensions: 11014 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -