BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0502 (602 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21610.1 68415.m02570 pectinesterase family protein contains ... 30 1.0 At5g47480.1 68418.m05863 expressed protein 27 9.6 >At2g21610.1 68415.m02570 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 352 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -3 Query: 318 GLYSRNARRCVTAIHYVLVLNIFGLAGWYT*DLYKSLSP 202 GLY ++R + H+++++NIF L+ + + S SP Sbjct: 2 GLYKTKSKRSIANYHHIIIINIFILSSITSSSMASSSSP 40 >At5g47480.1 68418.m05863 expressed protein Length = 1350 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 329 GQLSTHQPGSCLAGSVRTTSRSDSNQLEDTDIITS 433 G + +P S +A SD+N+L D D++ S Sbjct: 84 GSVGKEEPSSSIAPEAVQFVNSDANRLRDVDVVRS 118 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,607,206 Number of Sequences: 28952 Number of extensions: 218266 Number of successful extensions: 418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -