BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0498 (571 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF077533-3|AAC64626.1| 1023|Caenorhabditis elegans Hypothetical ... 27 9.5 AC006633-6|AAK68378.4| 578|Caenorhabditis elegans Hypothetical ... 27 9.5 >AF077533-3|AAC64626.1| 1023|Caenorhabditis elegans Hypothetical protein F54G2.2 protein. Length = 1023 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -1 Query: 271 RTVMPHFSSAYGVDASTGRRKQSQWVSPR*HHRSTDEILTSQKS 140 RT++P+ +A A + Q +PR +HR T+EI+ S Sbjct: 250 RTILPNRRTARRAGAGEHFQNVVQIETPRAYHRETEEIIDDTAS 293 >AC006633-6|AAK68378.4| 578|Caenorhabditis elegans Hypothetical protein F35B3.7 protein. Length = 578 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +1 Query: 196 PIDFVCAYRYSHQRHT 243 PIDFV + RYSHQ T Sbjct: 302 PIDFVTSTRYSHQEAT 317 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,290,454 Number of Sequences: 27780 Number of extensions: 250161 Number of successful extensions: 525 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 525 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1187327456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -