BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0492 (632 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 24 1.4 DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 23 3.3 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 4.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.3 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 5.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.7 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 7.5 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.8 bits (49), Expect = 1.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 257 FR*RRNPHFQPRPEVF 304 F+ R PH P P+VF Sbjct: 445 FKLHRQPHIYPNPDVF 460 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +1 Query: 565 ITVNYSNDTCESKINYVL 618 I N S D CE+ +N+++ Sbjct: 119 INANKSTDKCENGLNFII 136 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 349 VASATTFSRASPPEAKDLRTRLKMRISP 266 + +T+F R PP A R L R P Sbjct: 378 IGPSTSFPRFIPPNAYRFRPPLNPRFGP 405 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +1 Query: 526 PCSGVRRPTRHQQITVNYSNDTCESKINY 612 P ++ RH ++ + D C+ +INY Sbjct: 200 PMPTLKGDGRHMEVIKIKNFDNCDQRINY 228 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.8 bits (44), Expect = 5.7 Identities = 33/124 (26%), Positives = 49/124 (39%), Gaps = 9/124 (7%) Frame = +3 Query: 216 QLSPGCSQSFSISGSAEGEI---RIFSRVLRSFASGGLALENVVA-EATASVSLADNIIV 383 Q P + F+I+ +G+ + ++ + A+ LAL N+V T V A N Sbjct: 55 QTGPTHAPIFTIAVQIDGQTYEGKGRTKKMAKHAAAELALRNIVQFRNTPEVHQAINTCQ 114 Query: 384 SDIGAAITI-GDV--KSNLQINLFGR--EVGPAVNNFLEKIPVYLTDTQPRSAVFWSTSP 548 I DV + N +N F + N FLEK PV L + V+ S Sbjct: 115 PSIPLEPDFTSDVTERDNHLVNAFKTLTQEPKNTNKFLEKGPVALINELYPGVVYKCVSD 174 Query: 549 NSSS 560 N S Sbjct: 175 NGES 178 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 365 EGDGSGSLSNDVLKGKSSGSERP 297 EG G SL + +G+ +G+E P Sbjct: 731 EGSGGDSLRTLLQRGQETGAEWP 753 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.4 bits (43), Expect = 7.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 395 SCNNYW 412 SCNNYW Sbjct: 100 SCNNYW 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,295 Number of Sequences: 438 Number of extensions: 2955 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -