BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0491 (762 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0306 + 42638683-42638990,42639074-42639314,42639935-426402... 29 5.3 02_05_1011 + 33487670-33487958,33490794-33492100,33492541-334928... 28 7.1 02_01_0362 + 2607097-2607371,2607766-2608612,2608842-2608910,260... 28 9.3 >01_07_0306 + 42638683-42638990,42639074-42639314,42639935-42640236, 42640431-42640607,42640853-42641617,42641697-42641791, 42641889-42641951,42642047-42642135,42642229-42642324, 42642457-42643104,42643596-42643628,42643838-42643912, 42644442-42644603,42644604-42644674,42644758-42644815, 42645196-42645394,42645487-42645552,42645699-42646183 Length = 1310 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 46 PRLWGIIANPNPQHEGVSAGCPGL*ARENML 138 P LW +++ P P+++ + G PG R +L Sbjct: 1110 PFLWNVLSAPLPKNDAIDGGLPGSADRPKLL 1140 >02_05_1011 + 33487670-33487958,33490794-33492100,33492541-33492853, 33493190-33494247 Length = 988 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -2 Query: 113 PGQPAETPSCWGLGFAIIPHKRGIPSKR 30 PG+P +TP W + + +P + +P+KR Sbjct: 443 PGEPRDTPRGWTVSPSGLPLRVSVPTKR 470 >02_01_0362 + 2607097-2607371,2607766-2608612,2608842-2608910, 2609968-2610202,2610454-2610536,2610924-2611046, 2611326-2611379 Length = 561 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 72 PQSPARRSFSGLPGPLGQGEHADSFSVARVRPRTS 176 PQ P F GLP +G +H D ++A P S Sbjct: 278 PQKPVENFFKGLPYAVGD-QHGDWIAIAHQHPLLS 311 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,784,390 Number of Sequences: 37544 Number of extensions: 381046 Number of successful extensions: 975 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 975 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -