BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0491 (762 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38360.2 68417.m05424 expressed protein contains Pfam profile... 31 0.84 At5g67240.1 68418.m08475 exonuclease family protein contains exo... 29 4.5 At4g10210.1 68417.m01674 hypothetical protein IB1C3-1 protein, A... 28 5.9 At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fruc... 28 7.8 >At4g38360.2 68417.m05424 expressed protein contains Pfam profile PF03619: Domain of unknown function Length = 485 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 60 DNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPRTSKGIT 188 D+C SP+RR G+ PL G +DS + R G T Sbjct: 415 DSCMSSSPSRRVIRGIDDPLLNGSFSDSGVTRTKKHRRKSGYT 457 >At5g67240.1 68418.m08475 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 745 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 625 VSSTGCHTDYPAGFIRPGHYHDWYLEVTG 539 V T H DYP + P + DWY+ G Sbjct: 105 VRLTITHDDYPGNYTFPSYAEDWYVTELG 133 >At4g10210.1 68417.m01674 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 375 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +3 Query: 30 ALTRNSSFMGDNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPRTSKGI 185 AL + SF GDN PQS +++ P G H + +PR G+ Sbjct: 141 ALLKMKSFDGDNSNPQSSWSKTYK--PTSSNGGHHFAVVRTTKGKPRRYNGV 190 >At3g13784.1 68416.m01741 beta-fructosidase, putative / beta-fructofuranosidase, putative / cell wall invertase, putative similar to beta-fructofuranosidase GI:402740 from [Arabidopsis thaliana] Length = 569 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -2 Query: 191 VCDALRCPGPHARYTEGISMFSL--A*RPGQPAETPSCWGLGFAIIPHKRGI 42 V D + HA T+ I+ +L A RP +P++ CW I+P+ + + Sbjct: 77 VMDVNKTVWGHATSTDLINWITLSPAIRPSRPSDINGCWSGSVTILPNGKPV 128 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,102,936 Number of Sequences: 28952 Number of extensions: 277999 Number of successful extensions: 630 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1702303248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -