BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0488 (802 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC018734-1|AAH18734.1| 439|Homo sapiens amidohydrolase domain c... 63 1e-09 AF132948-1|AAD27723.1| 404|Homo sapiens CGI-14 protein protein. 63 1e-09 AB058704-1|BAB47430.1| 1227|Homo sapiens KIAA1801 protein protein. 30 8.5 >BC018734-1|AAH18734.1| 439|Homo sapiens amidohydrolase domain containing 2 protein. Length = 439 Score = 62.9 bits (146), Expect = 1e-09 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = +3 Query: 12 ALEAASLHPAKALGIDDKKGNLNFDSDADFVILHPKTLKVQSTWIAGECVYK 167 ALEAASLHPA+ LG++ KG L+F +DADFV+L +L VQ+T+I+GE V++ Sbjct: 383 ALEAASLHPAQLLGLEKSKGTLDFGADADFVVL-DDSLHVQATYISGELVWQ 433 >AF132948-1|AAD27723.1| 404|Homo sapiens CGI-14 protein protein. Length = 404 Score = 62.9 bits (146), Expect = 1e-09 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = +3 Query: 12 ALEAASLHPAKALGIDDKKGNLNFDSDADFVILHPKTLKVQSTWIAGECVYK 167 ALEAASLHPA+ LG++ KG L+F +DADFV+L +L VQ+T+I+GE V++ Sbjct: 348 ALEAASLHPAQLLGLEKSKGTLDFGADADFVVL-DDSLHVQATYISGELVWQ 398 >AB058704-1|BAB47430.1| 1227|Homo sapiens KIAA1801 protein protein. Length = 1227 Score = 30.3 bits (65), Expect = 8.5 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 800 VPTILM*LWIVYTLIINKCKC*VIIQYLYWEC 705 +PT L WI T + C +I +LYW C Sbjct: 823 IPTGLCWSWIPITSLTKNSDCNFLISHLYWNC 854 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,108,963 Number of Sequences: 237096 Number of extensions: 1819401 Number of successful extensions: 2056 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2056 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9869080686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -