SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0482
         (662 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory recept...    23   1.7  

>AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory receptor
           candidate 53 protein.
          Length = 659

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +3

Query: 189 NFFTGSKFKIKLYLNYY*ISWGLFIRIKCFCQVDIKSLIAYSSV 320
           +FF  S F I L L    IS  +   +  F  + +KS +A+ ++
Sbjct: 136 HFFLRSLFAIMLPLGILLISQDVIANVLLFIFIVVKSGVAFQTI 179


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,993
Number of Sequences: 336
Number of extensions: 1589
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17177325
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -