BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0430 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 28 0.074 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 1.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 1.2 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 4.9 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.9 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 22 4.9 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.5 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 28.3 bits (60), Expect = 0.074 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -2 Query: 622 ASSQQCCWK*LVYVVHSAWRIHVCILTHGHSLSWGIPKN 506 A++ CW + Y+V AW I ++ L WG N Sbjct: 65 AAAVMSCWMNVYYIVILAWAIFYFFMSMRSELPWGSCNN 103 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -2 Query: 604 CWK*LVYVVHSAWRIHVCILTHGHSLSW---GIPKNVR 500 CW + Y++ AW + +++ L W G P N R Sbjct: 109 CWTNIYYIIILAWALFYLLVSLRIDLPWRTCGNPWNTR 146 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -2 Query: 604 CWK*LVYVVHSAWRIHVCILTHGHSLSW---GIPKNVR 500 CW + Y++ AW + +++ L W G P N R Sbjct: 162 CWTNIYYIIILAWALFYLLVSLRIDLPWRTCGNPWNTR 199 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 179 LGDYRLR*RGVLLPSRRRGKSS 244 + DY++ + +LLP R GKS+ Sbjct: 128 VADYKIEGKVLLLPVRGAGKSN 149 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 369 RIRGINQVSPKSVKFCNCLDC 431 + GI+ +P C+CLDC Sbjct: 312 KYEGISS-TPSQASSCSCLDC 331 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 605 LLEVIGIRCPLSLAN 561 ++E+IGI C L LAN Sbjct: 206 IVELIGIICALCLAN 220 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 8.5 Identities = 12/47 (25%), Positives = 19/47 (40%) Frame = +2 Query: 365 HPNPWYQPSFTEVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPY 505 H W Q F ++ + + N G+ RL T + RI + Y Sbjct: 2 HHRMWLQQIFILLQMIHLIAWASLENTGISDRLENVTQTISRILDGY 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,399 Number of Sequences: 438 Number of extensions: 3785 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -