BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0424 (724 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0438 + 21244735-21244782,21245089-21245274,21245307-212453... 31 0.70 04_01_0011 + 207319-207605,207935-208184,208559-208729 28 6.5 >05_04_0438 + 21244735-21244782,21245089-21245274,21245307-21245384, 21245385-21245678,21246137-21246262,21246935-21247168, 21247534-21248061 Length = 497 Score = 31.5 bits (68), Expect = 0.70 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 22 RIV*NPK*DDTFKSISLFVIAVKLPCVFIAAHLQTGFAAF 141 R++ P S+SL V+ V + CVF+A HL+ F+ + Sbjct: 23 RLIFGPDAKSLLVSVSLIVVPVLVFCVFVARHLRHQFSTY 62 >04_01_0011 + 207319-207605,207935-208184,208559-208729 Length = 235 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 372 HRHLQCKCGYNGSAPPFKPKRITAS 298 HR++ C N SAP F+P +I A+ Sbjct: 38 HRYVGCCHNINASAPDFRPHQINAA 62 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,598,302 Number of Sequences: 37544 Number of extensions: 382047 Number of successful extensions: 871 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 870 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -