BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0424 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 27 0.59 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 26 1.0 DQ990877-1|ABJ90145.1| 105|Anopheles gambiae putative salivary ... 23 7.2 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 27.1 bits (57), Expect = 0.59 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 570 IVPQAVKGTDAVGAMAAGSFIYVVGFTN 487 IV AV A+GA++ GS VVG+TN Sbjct: 23 IVAAAVAAAAAIGAVSGGSAGGVVGWTN 50 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 26.2 bits (55), Expect = 1.0 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -3 Query: 452 TRSRSERIA*MGGR-AHSPPGVKWLLELIDIYNVNVVTTALPHPSNRNASL 303 TR+ S+ ++ + + A + G++ + ELID Y ++VV + H +NA L Sbjct: 943 TRNLSDNLSDLRAQIAANQKGIQLVSELIDAYGLSVVQAYMGH-MQQNAEL 992 >DQ990877-1|ABJ90145.1| 105|Anopheles gambiae putative salivary secreted peptide protein. Length = 105 Score = 23.4 bits (48), Expect = 7.2 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +3 Query: 135 CILYFSLPHCMLFSTASLSVSWTPLDR--ALTWHLYWW*DLL 254 CIL F + +L S+A + TP+ + AL HL + D L Sbjct: 5 CILLFFIAMLVLVSSAPAESNQTPVSKAIALIHHLSYLIDYL 46 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 732,652 Number of Sequences: 2352 Number of extensions: 13396 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -