BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0420 (630 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1369 + 29620958-29621030,29622421-29622452,29622538-296225... 28 5.3 02_05_0735 + 31322033-31322201,31322702-31322795,31322902-313229... 27 9.3 >06_03_1369 + 29620958-29621030,29622421-29622452,29622538-29622598, 29622695-29622711,29622916-29623250,29623329-29623686, 29623784-29624371,29624664-29624939 Length = 579 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -1 Query: 309 ISIKSVYFPSLLSPRQIILWSKRTDIKLENF 217 +++ L S +Q++ WS + +IKL+NF Sbjct: 20 VAVTGAQVDPLYSSKQVLDWSSQANIKLQNF 50 >02_05_0735 + 31322033-31322201,31322702-31322795,31322902-31322954, 31323560-31323915,31324183-31324394,31324761-31325043 Length = 388 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 45 ILKINLPRSQRKEAVSPHYVGTCVSTKIKMEPELN 149 I++ L R++ + A+S HY TCVS ++ LN Sbjct: 313 IVEYFLWRNKAEYAISVHYDRTCVSEEVLQNKRLN 347 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,262,852 Number of Sequences: 37544 Number of extensions: 322760 Number of successful extensions: 550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -