BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0420 (630 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01080.1 68417.m00146 expressed protein 27 7.8 At3g17620.1 68416.m02251 F-box family protein contains Pfam prof... 27 7.8 >At4g01080.1 68417.m00146 expressed protein Length = 442 Score = 27.5 bits (58), Expect = 7.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 319 HNHRCHIKYFSFFETRGTQYYWVTGS 396 H HR +K+F +F YY++ S Sbjct: 43 HRHRTFVKFFLYFSLVALAYYFIISS 68 >At3g17620.1 68416.m02251 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 398 Score = 27.5 bits (58), Expect = 7.8 Identities = 14/56 (25%), Positives = 25/56 (44%) Frame = +1 Query: 364 RGTQYYWVTGSHVNTTTRLKHEIEISIAFKFKS*KGIPAL*FLCAPISKRHASMNS 531 +G Y++ T ++ L H + + F F S + P L C P+ S++S Sbjct: 209 KGNTYWFATDKFPEISSNLIHSVYFLLCFNFTSERFGPRLHLPCYPMDVDTVSLSS 264 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,377,507 Number of Sequences: 28952 Number of extensions: 273210 Number of successful extensions: 594 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -