BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0418 (509 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 2.0 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 24 3.4 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 33 KQRTTTGNKRCSIR*SYSHRRIWCQQKRLGRCY 131 K R+ T RC +R + H+R W + CY Sbjct: 446 KNRSLTEMGRCMLRDAGMHKRFWAEAVNTA-CY 477 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 23.8 bits (49), Expect = 3.4 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +2 Query: 206 ALMKFLLQQLRMANITESVQHRSGDNRK*LPRIYS*NGYCQTC 334 A+ KF+++ + A + S + LP++Y+ YC +C Sbjct: 34 AIKKFVIRNIVEAAAVRDISDASVYSSYVLPKLYAKLHYCVSC 76 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 540,333 Number of Sequences: 2352 Number of extensions: 11090 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -