BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0418 (509 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024796-2|AAK29892.2| 446|Caenorhabditis elegans Hypothetical ... 30 0.85 Z99169-1|CAB16306.2| 966|Caenorhabditis elegans Hypothetical pr... 29 2.0 AB055112-1|BAB62293.1| 966|Caenorhabditis elegans VHA-7 protein. 29 2.0 Z83239-9|CAB05811.1| 517|Caenorhabditis elegans Hypothetical pr... 28 3.4 Z81099-4|CAB03189.1| 517|Caenorhabditis elegans Hypothetical pr... 28 3.4 >AC024796-2|AAK29892.2| 446|Caenorhabditis elegans Hypothetical protein Y48G1C.4 protein. Length = 446 Score = 30.3 bits (65), Expect = 0.85 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = -1 Query: 386 EWVPHA-GIYSEHSRPMLYKFGSTHFNYKS 300 EW HA G+++EH+ ++ GS+++ Y+S Sbjct: 354 EWTFHAKGLWAEHNNQLMTLIGSSNYGYRS 383 >Z99169-1|CAB16306.2| 966|Caenorhabditis elegans Hypothetical protein C26H9A.1 protein. Length = 966 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 100 QIRRCE*LQRIEHRLFPVVVRCFPNHEPKGLD 5 Q+RRCE ++R L V+ C P +PK +D Sbjct: 98 QMRRCEEMERKLRFLEKQVITCKPGLDPKSID 129 >AB055112-1|BAB62293.1| 966|Caenorhabditis elegans VHA-7 protein. Length = 966 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 100 QIRRCE*LQRIEHRLFPVVVRCFPNHEPKGLD 5 Q+RRCE ++R L V+ C P +PK +D Sbjct: 98 QMRRCEEMERKLRFLEKQVITCKPGLDPKSID 129 >Z83239-9|CAB05811.1| 517|Caenorhabditis elegans Hypothetical protein K08F9.4 protein. Length = 517 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 204 PRL*SFCCNNYAWQTLRNQCSTEAEITANN 293 P+ +FC NN+ W+ R +C E IT N Sbjct: 259 PKRNTFCTNNFNWKIFRKKC-RENSITPPN 287 >Z81099-4|CAB03189.1| 517|Caenorhabditis elegans Hypothetical protein K08F9.4 protein. Length = 517 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 204 PRL*SFCCNNYAWQTLRNQCSTEAEITANN 293 P+ +FC NN+ W+ R +C E IT N Sbjct: 259 PKRNTFCTNNFNWKIFRKKC-RENSITPPN 287 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,672,660 Number of Sequences: 27780 Number of extensions: 248437 Number of successful extensions: 620 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -