BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0413 (613 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 0.83 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 25 1.5 Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein... 24 4.4 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 23 7.8 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 7.8 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.2 bits (55), Expect = 0.83 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -2 Query: 390 GSERPQDAAENADFSFSGTD*C*NSGN 310 GSE+P++A E + + SGTD +SG+ Sbjct: 1348 GSEKPKNAIEPSQEAVSGTDNANDSGD 1374 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 25.4 bits (53), Expect = 1.5 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 427 TASVSLADNIIVSDIGAAITIGDVKSNPKSISSDA 531 TA V L + +DI I I D+ NP SDA Sbjct: 77 TAEVDLGQYRLPADIDIVIDIFDIHRNPAYWGSDA 111 >Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 546 VNNFLEKIPVYLTDYAAEVS 605 VN EK+P YL++ +A V+ Sbjct: 88 VNAIYEKLPAYLSEVSARVN 107 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 23.0 bits (47), Expect = 7.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 318 SGNSQD*VESGADVADTTKC 259 SG S +E+G + DT KC Sbjct: 43 SGESNARIENGTIICDTLKC 62 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 7.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 432 SGSLSNDVLKGKSSGSERPQDAAENADFSFSGTD 331 S ++ ND +K +SGS + Q E F F D Sbjct: 1270 SVTIKNDPMK--TSGSTQQQQQMERQQFGFGNND 1301 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,995 Number of Sequences: 2352 Number of extensions: 10538 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -