BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0405 (612 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 28 0.054 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.66 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 23 1.5 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 8.2 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 28.3 bits (60), Expect = 0.054 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 5/69 (7%) Frame = +1 Query: 373 RSNSNIAYNNNVRPINIAGANYNLGDNQVVWAAG----W-GATSLGGSNSGNSVTSRSGP 537 + NSN Y++N +P G G VV AA W ATS GG+N NS+T P Sbjct: 84 QQNSN--YSSNSKPDCSKGNADQNGYASVVAAAAVKDVWQSATSGGGANLTNSLTGPVRP 141 Query: 538 SIRMPASNV 564 + P S V Sbjct: 142 AACTPDSRV 150 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 24.6 bits (51), Expect = 0.66 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 524 DVTELPELDPPSDVAPQPA 468 D T PE DP VAP+PA Sbjct: 75 DGTTSPEPDPEIPVAPEPA 93 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 23.4 bits (48), Expect = 1.5 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 487 SLGGSNSGNSVTSRSGPSIRMPASNVTDPLTVLS 588 S+GG N+GN++ + S ++ AS ++ L+ S Sbjct: 101 SIGGWNAGNAILNGIVASSKLRASLISSCLSFFS 134 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.0 bits (42), Expect = 8.2 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -1 Query: 570 VCNVGRRHSD*WSRPGRDGVARIRPSERCSTPTSS 466 + N+ SD S P + ++ CSTPT + Sbjct: 406 IANLPSPGSDQRSTPSPRVYGNVNENQDCSTPTEN 440 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,201 Number of Sequences: 336 Number of extensions: 3806 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -