BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0399 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.12 |rhp23||Rad23 homolog Rhp23|Schizosaccharomyces pomb... 26 4.6 SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr ... 26 6.0 >SPBC2D10.12 |rhp23||Rad23 homolog Rhp23|Schizosaccharomyces pombe|chr 2|||Manual Length = 368 Score = 26.2 bits (55), Expect = 4.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 374 SRPSPEHNSPQHSASTTSNEVKTTPESKSVDPSN 475 SRP ++P+ +AS N + PE K PS+ Sbjct: 73 SRPKTSTSTPKSAASPAPNPPASVPEKKVEAPSS 106 >SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 791 Score = 25.8 bits (54), Expect = 6.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Frame = +2 Query: 371 PSRPSPEHNS----PQHSASTTSNEVKTTPESKSV 463 PS+P+P + S PQ S ++ ++ TTP+S SV Sbjct: 450 PSKPAPVNASRPMMPQQSNNSEASIPSTTPQSPSV 484 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,193,522 Number of Sequences: 5004 Number of extensions: 36537 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -