BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0399 (706 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) 29 3.7 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 >SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2988 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 3/73 (4%) Frame = -2 Query: 606 INVAKMINIKNITCFKPLKH-SPVKLLSFEIVQFN-ARRRYVLD-Y*LEGSTDFDSGVVL 436 I + + N+ N+TC L+H SPV ++ VQ N +V+D L TD++ +V+ Sbjct: 1133 IFASSICNVANVTCVWSLRHGSPVHHVTRRAVQENLVSGEFVVDKNSLNPDTDYNIVLVV 1192 Query: 435 TSLEVVDAECWGL 397 T E +G+ Sbjct: 1193 TGNETTTFAMYGI 1205 >SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) Length = 610 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 380 PSPEHNSPQHSASTTSNEVKTTPESKSVDPS 472 P ++PQH +TT+N T P + + +P+ Sbjct: 28 PHDSRSTPQHQRTTTANFPSTNPHNSTTNPT 58 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 371 PSRPSPEHNSPQHSASTTS-NEVKTTPESKSVDPS 472 P +PSP N + S STTS +K +P + + PS Sbjct: 1275 PIKPSPSTNPIKPSPSTTSTTPIKPSPSTTPIKPS 1309 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,500,882 Number of Sequences: 59808 Number of extensions: 270745 Number of successful extensions: 626 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -