BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0397 (455 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006807-4|AAK84618.1| 904|Caenorhabditis elegans Hypothetical ... 28 2.8 Z81071-2|CAB03012.1| 618|Caenorhabditis elegans Hypothetical pr... 27 8.6 >AC006807-4|AAK84618.1| 904|Caenorhabditis elegans Hypothetical protein Y58A7A.4 protein. Length = 904 Score = 28.3 bits (60), Expect = 2.8 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = -3 Query: 186 VNLTLRTRQLIVAARLTTKLRKSLSLEVILPILKALALSVDLGSATSLVDTATIAVNTNN 7 + + RTR L + +L + K+ L + ILK L LG+A LV+ T ++ N Sbjct: 786 MRICARTRDLRLDIKLRNRFLKAEQLLIKNGILKTEILENLLGTALYLVENVTAWMHMTN 845 Query: 6 R 4 R Sbjct: 846 R 846 >Z81071-2|CAB03012.1| 618|Caenorhabditis elegans Hypothetical protein F28F8.2 protein. Length = 618 Score = 26.6 bits (56), Expect = 8.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 376 ACKRQNMHFSVPKFVR*KK 320 ACKR H+ VPK+V KK Sbjct: 560 ACKRGMAHYKVPKYVLIKK 578 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,242,679 Number of Sequences: 27780 Number of extensions: 132536 Number of successful extensions: 318 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 318 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 809909048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -