BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0395 (396 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1069 - 9493001-9493176,9493269-9493300,9493405-9493499,949... 27 4.1 06_01_0225 - 1727461-1728825 27 7.2 >07_01_1069 - 9493001-9493176,9493269-9493300,9493405-9493499, 9493623-9493898,9493976-9494039,9498048-9498113, 9498283-9498413,9499722-9499859,9499964-9500079, 9500166-9500331,9500435-9500548,9500609-9500692, 9500995-9501073,9501134-9501337,9501999-9502096, 9502187-9502284,9502359-9502495,9502606-9502824, 9503541-9503743,9503856-9504005 Length = 881 Score = 27.5 bits (58), Expect = 4.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 142 FVNFEKRVTNFCYLFLRYYGVCSCYFYYFK 53 +V E TN LF+ YYG C+ + Y+FK Sbjct: 350 YVPIEVAGTNPVCLFISYYGCCAIW-YHFK 378 >06_01_0225 - 1727461-1728825 Length = 454 Score = 26.6 bits (56), Expect = 7.2 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -3 Query: 103 LFLRYYGVCSCYFYYFKREIIVL----PYLYQYVGY 8 LF +YY V CY Y+ + + L Y YQ+ Y Sbjct: 370 LFRQYYVVVICYIYFTRVVVYALMTITSYRYQWTSY 405 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,538,207 Number of Sequences: 37544 Number of extensions: 144980 Number of successful extensions: 335 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 335 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 684860244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -