BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0394 (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47887| Best HMM Match : PAN (HMM E-Value=4.1e-07) 29 4.6 SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 >SB_47887| Best HMM Match : PAN (HMM E-Value=4.1e-07) Length = 494 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = -1 Query: 297 KVNELGVLMNLNAVHRGFQPNFTFKNETIKHHQNR-GLVESYKSSKNRFESILFSSQTKR 121 K+ +LG L L A F P F F N I+ ++ +V++ KS N +++ + Q Sbjct: 379 KMLDLGNLGLLLASMLFFAPGFVFLNVGIRCQNHKVDVVDTAKSKNNGLQALSYCKQVDE 438 Query: 120 TL 115 TL Sbjct: 439 TL 440 >SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3176 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = -1 Query: 231 TFKNETIKHHQNRGLVESYKSSKNRFESILFSSQTKR 121 TFK + I+H ++ L+ ++ +K+ E ILF Q+K+ Sbjct: 420 TFKEKYIEHPKDFELIAAFLENKSVSECILFYYQSKK 456 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,208,518 Number of Sequences: 59808 Number of extensions: 262739 Number of successful extensions: 549 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -