BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0394 (684 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060984-1|AAL28532.1| 730|Drosophila melanogaster GM14169p pro... 29 4.5 AF123262-1|AAD22056.1| 730|Drosophila melanogaster TXBP181-like... 29 4.5 AE013599-845|AAF58955.1| 730|Drosophila melanogaster CG2072-PA ... 29 4.5 >AY060984-1|AAL28532.1| 730|Drosophila melanogaster GM14169p protein. Length = 730 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = -1 Query: 273 MNLNAVHRGFQPNFTFKNETIKHHQNRGLVESYKSSKNRFESI 145 + + +HR + +F K+ + H E+Y+S+KN E + Sbjct: 533 LEMEMMHRCLRGDFNMKDFKVVHFSENPAAEAYESTKNMMEKL 575 >AF123262-1|AAD22056.1| 730|Drosophila melanogaster TXBP181-like protein protein. Length = 730 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = -1 Query: 273 MNLNAVHRGFQPNFTFKNETIKHHQNRGLVESYKSSKNRFESI 145 + + +HR + +F K+ + H E+Y+S+KN E + Sbjct: 533 LEMEMMHRCLRGDFNMKDFKVVHFSENPAAEAYESTKNMMEKL 575 >AE013599-845|AAF58955.1| 730|Drosophila melanogaster CG2072-PA protein. Length = 730 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = -1 Query: 273 MNLNAVHRGFQPNFTFKNETIKHHQNRGLVESYKSSKNRFESI 145 + + +HR + +F K+ + H E+Y+S+KN E + Sbjct: 533 LEMEMMHRCLRGDFNMKDFKVVHFSENPAAEAYESTKNMMEKL 575 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,190,803 Number of Sequences: 53049 Number of extensions: 382272 Number of successful extensions: 686 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2992560750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -