BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0392 (787 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 40 9e-05 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 40 9e-05 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 40 9e-05 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 26 1.1 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 8.1 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 39.9 bits (89), Expect = 9e-05 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = +1 Query: 526 KDFSGGWRMRIALARALYVKPHLLLLDEPTNHLD 627 K SGG R R+A A PHLLL DEPT+ LD Sbjct: 242 KGLSGGERKRLAFASETLTDPHLLLCDEPTSGLD 275 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 39.9 bits (89), Expect = 9e-05 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = +1 Query: 526 KDFSGGWRMRIALARALYVKPHLLLLDEPTNHLD 627 K SGG R R+A A PHLLL DEPT+ LD Sbjct: 242 KGLSGGERKRLAFASETLTDPHLLLCDEPTSGLD 275 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 39.9 bits (89), Expect = 9e-05 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = +1 Query: 526 KDFSGGWRMRIALARALYVKPHLLLLDEPTNHLD 627 K SGG R R+A A PHLLL DEPT+ LD Sbjct: 220 KGLSGGERKRLAFASETLTDPHLLLCDEPTSGLD 253 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +3 Query: 189 LVGLNGCGKSSLLAAL 236 LVG NG GKS++LAA+ Sbjct: 112 LVGKNGSGKSAILAAM 127 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.4 bits (48), Expect = 8.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 473 QHAPLPCRRSNRPDD 429 +H P PCR RP+D Sbjct: 665 RHCPAPCRCYIRPED 679 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 803,316 Number of Sequences: 2352 Number of extensions: 16582 Number of successful extensions: 69 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -