BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0392 (787 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 26 0.46 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 25 0.80 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.4 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.4 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 9.8 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 25.8 bits (54), Expect = 0.46 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 6/45 (13%) Frame = +2 Query: 563 WHERYMLSRTY----CCWTSQQTISIWTPVCGLKKNL--NTTKEF 679 W+ RY L+ T CWT + I TP+ L L + KEF Sbjct: 196 WNTRYCLTPTERLEALCWTQDEDIICSTPIGNLSHALLKDPVKEF 240 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 25.0 bits (52), Expect = 0.80 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 Query: 546 PTSGEVFRCLLLHSLVKPRPCRILAARASAVSALKSSRR 430 P SG+ F L L PRPC +LA + L++ R Sbjct: 176 PKSGKGFS-LFARFLKNPRPCNVLATSLTEPYTLRNYGR 213 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 634 TCVWLEEELKHYKRILVLISHSQD 705 T VW+E LKH+ + V+ HS D Sbjct: 155 TDVWVEL-LKHFNYMKVIFIHSSD 177 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/45 (22%), Positives = 21/45 (46%) Frame = +3 Query: 240 RREVPFRNTLTYSI*LEKCLLQIRLHFSASWRLTRRESNSRSSQK 374 R ++N + +++ L KC +++ A W + E R Q+ Sbjct: 543 RNAATWKNAVRHNLSLHKCFMRVENVKGAVWTVDEVEFYKRRPQR 587 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 598 LLDEPTNHLDLDTCVWLEEELKHYK 672 L+D + + T VW+E+E YK Sbjct: 57 LIDVNLKNQIMTTNVWVEQEWNDYK 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,183 Number of Sequences: 438 Number of extensions: 4401 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -