BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0391 (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_57906| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 >SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 166 PFATAPSLHSPDSGRSDPRYANAPRRNP 249 P T PS H P G+++ + NA R NP Sbjct: 621 PVETEPSYHQPPRGQTNGQATNAQRANP 648 >SB_57906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 398 Score = 28.7 bits (61), Expect = 5.0 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 342 PRYRKSASLDAPH-VAPRPNLPKRFSVAEDGFRELDRXXXXXGESAWMP 485 P Y S D H V+P+P+LP ++ GFRE SA +P Sbjct: 57 PVYTPVPSSDPHHTVSPQPDLPPHYNHRSPGFREGSMSPIVQQYSAHLP 105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,766,207 Number of Sequences: 59808 Number of extensions: 222501 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -