BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0384 (470 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0) 60 1e-09 SB_30340| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_37670| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 >SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0) Length = 1596 Score = 59.7 bits (138), Expect = 1e-09 Identities = 22/49 (44%), Positives = 33/49 (67%) Frame = +2 Query: 107 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDY 253 LVDP ++RE C +KP+ + + C +RVNS+S T ETC +EL+D+ Sbjct: 372 LVDPMDAIRESCEEKPECSKLKLELSNCEERVNSKSSTTETCAQELLDF 420 >SB_30340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 137 ECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELI 247 EC +KP MW +Y+ D++ SR + +E I Sbjct: 36 ECCRKPLVYYMWYRYERFEDKMKSRERYENEGNQEKI 72 >SB_37670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 158 AQNMWAKYQECNDRVNSRSKTAETCEEELIDYAMFLTNASPRTCLR 295 A + +++ + ND+ + S + C + L+DY F++ SP+ C R Sbjct: 578 ALGLLSRFSQMNDQTSVFSLLTKPCIKCLLDYVSFVSKPSPK-CAR 622 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,886,421 Number of Sequences: 59808 Number of extensions: 197681 Number of successful extensions: 368 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -