BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0384 (470 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT007070-1|AAP35733.1| 91|Homo sapiens ubiquinol-cytochrome c ... 48 2e-05 BC107703-1|AAI07704.1| 91|Homo sapiens ubiquinol-cytochrome c ... 48 2e-05 BC015177-1|AAH15177.1| 91|Homo sapiens ubiquinol-cytochrome c ... 48 2e-05 BC001934-1|AAH01934.1| 91|Homo sapiens ubiquinol-cytochrome c ... 48 2e-05 BC001426-1|AAH01426.1| 91|Homo sapiens ubiquinol-cytochrome c ... 48 2e-05 AL122001-4|CAI21963.1| 91|Homo sapiens ubiquinol-cytochrome c ... 48 2e-05 BC093060-1|AAH93060.1| 85|Homo sapiens UQCRH protein protein. 47 4e-05 Y00764-1|CAA68733.1| 91|Homo sapiens protein ( Human mRNA for ... 45 2e-04 M36647-1|AAA36317.1| 91|Homo sapiens protein ( Homo sapiens mi... 45 2e-04 DQ926238-1|ABK81457.1| 119|Homo sapiens immunoglobulin heavy ch... 29 6.1 X13230-1|CAA31617.1| 567|Homo sapiens protein ( Human mRNA for ... 29 8.1 X12556-1|CAA31069.1| 925|Homo sapiens protein ( Human mRNA for ... 29 8.1 J03639-1|AAA52172.1| 478|Homo sapiens MCF2 protein. 29 8.1 AL161777-3|CAI39715.1| 1070|Homo sapiens MCF.2 cell line derived... 29 8.1 AL117234-1|CAB55301.1| 985|Homo sapiens hypothetical protein pr... 29 8.1 AL033403-7|CAI42108.1| 860|Homo sapiens MCF.2 cell line derived... 29 8.1 AL033403-6|CAA21955.1| 925|Homo sapiens MCF.2 cell line derived... 29 8.1 AL033403-5|CAI42107.1| 941|Homo sapiens MCF.2 cell line derived... 29 8.1 AL033403-4|CAI42106.1| 528|Homo sapiens MCF.2 cell line derived... 29 8.1 AL033403-3|CAI42105.1| 428|Homo sapiens MCF.2 cell line derived... 29 8.1 AL033403-2|CAI42104.1| 1070|Homo sapiens MCF.2 cell line derived... 29 8.1 AB209679-1|BAD92916.1| 435|Homo sapiens MCF.2 cell line derived... 29 8.1 AB085902-1|BAC41201.1| 941|Homo sapiens DBL proto-oncogene spli... 29 8.1 AB085901-1|BAC41200.1| 860|Homo sapiens DBL proto-oncogene spli... 29 8.1 >BT007070-1|AAP35733.1| 91|Homo sapiens ubiquinol-cytochrome c reductase hinge protein protein. Length = 91 Score = 47.6 bits (108), Expect = 2e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +2 Query: 107 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDY 253 LVDP ++RE+C Q + + C++RV+SRS T E C EEL D+ Sbjct: 26 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDF 74 >BC107703-1|AAI07704.1| 91|Homo sapiens ubiquinol-cytochrome c reductase hinge protein protein. Length = 91 Score = 47.6 bits (108), Expect = 2e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +2 Query: 107 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDY 253 LVDP ++RE+C Q + + C++RV+SRS T E C EEL D+ Sbjct: 26 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDF 74 >BC015177-1|AAH15177.1| 91|Homo sapiens ubiquinol-cytochrome c reductase hinge protein protein. Length = 91 Score = 47.6 bits (108), Expect = 2e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +2 Query: 107 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDY 253 LVDP ++RE+C Q + + C++RV+SRS T E C EEL D+ Sbjct: 26 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDF 74 >BC001934-1|AAH01934.1| 91|Homo sapiens ubiquinol-cytochrome c reductase hinge protein protein. Length = 91 Score = 47.6 bits (108), Expect = 2e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +2 Query: 107 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDY 253 LVDP ++RE+C Q + + C++RV+SRS T E C EEL D+ Sbjct: 26 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDF 74 >BC001426-1|AAH01426.1| 91|Homo sapiens ubiquinol-cytochrome c reductase hinge protein protein. Length = 91 Score = 47.6 bits (108), Expect = 2e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +2 Query: 107 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDY 253 LVDP ++RE+C Q + + C++RV+SRS T E C EEL D+ Sbjct: 26 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDF 74 >AL122001-4|CAI21963.1| 91|Homo sapiens ubiquinol-cytochrome c reductase hinge protein protein. Length = 91 Score = 47.6 bits (108), Expect = 2e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +2 Query: 107 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDY 253 LVDP ++RE+C Q + + C++RV+SRS T E C EEL D+ Sbjct: 26 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDF 74 >BC093060-1|AAH93060.1| 85|Homo sapiens UQCRH protein protein. Length = 85 Score = 46.8 bits (106), Expect = 4e-05 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +2 Query: 53 MSDKFVPVVXAXXXXXXXL-VDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAET 229 M D+ +P + A DP ++RE+C Q + + C++RV+SRS T E Sbjct: 1 MGDRILPFLAAVWLCQLAFCTDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEED 60 Query: 230 CEEELIDY 253 C EEL D+ Sbjct: 61 CTEELFDF 68 >Y00764-1|CAA68733.1| 91|Homo sapiens protein ( Human mRNA for mitochondrial hinge protein. ). Length = 91 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = +2 Query: 107 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDY 253 LVDP ++RE+C Q + + C++R +SRS T E C EEL D+ Sbjct: 26 LVDPLTTVREQCEQLEKCVKARERLELCDERDSSRSHTEEDCTEELFDF 74 >M36647-1|AAA36317.1| 91|Homo sapiens protein ( Homo sapiens mitochondrial hinge protein precursor, mRNA, complete cds. ). Length = 91 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = +2 Query: 107 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDY 253 LVDP ++RE+C Q + + C++R +SRS T E C EEL D+ Sbjct: 26 LVDPLTTVREQCEQLEKCVKARERLELCDERDSSRSHTEEDCTEELFDF 74 >DQ926238-1|ABK81457.1| 119|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 119 Score = 29.5 bits (63), Expect = 6.1 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 451 NYLYLQINSNNIGDSHILYINKFTKTTG 368 N LYLQ+NS GD+ + Y K TK +G Sbjct: 77 NSLYLQMNSLRPGDTALYYCAKDTKESG 104 >X13230-1|CAA31617.1| 567|Homo sapiens protein ( Human mRNA for MCF.2 protein 3'-end. ). Length = 567 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 225 DDFQMYAKYCQNKPRSETIWRKYSEC 250 >X12556-1|CAA31069.1| 925|Homo sapiens protein ( Human mRNA for dbl proto-oncogene. ). Length = 925 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 583 DDFQMYAKYCQNKPRSETIWRKYSEC 608 >J03639-1|AAA52172.1| 478|Homo sapiens MCF2 protein. Length = 478 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 136 DDFQMYAKYCQNKPRSETIWRKYSEC 161 >AL161777-3|CAI39715.1| 1070|Homo sapiens MCF.2 cell line derived transforming sequence protein. Length = 1070 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 728 DDFQMYAKYCQNKPRSETIWRKYSEC 753 >AL117234-1|CAB55301.1| 985|Homo sapiens hypothetical protein protein. Length = 985 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 643 DDFQMYAKYCQNKPRSETIWRKYSEC 668 >AL033403-7|CAI42108.1| 860|Homo sapiens MCF.2 cell line derived transforming sequence protein. Length = 860 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 583 DDFQMYAKYCQNKPRSETIWRKYSEC 608 >AL033403-6|CAA21955.1| 925|Homo sapiens MCF.2 cell line derived transforming sequence protein. Length = 925 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 583 DDFQMYAKYCQNKPRSETIWRKYSEC 608 >AL033403-5|CAI42107.1| 941|Homo sapiens MCF.2 cell line derived transforming sequence protein. Length = 941 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 599 DDFQMYAKYCQNKPRSETIWRKYSEC 624 >AL033403-4|CAI42106.1| 528|Homo sapiens MCF.2 cell line derived transforming sequence protein. Length = 528 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 186 DDFQMYAKYCQNKPRSETIWRKYSEC 211 >AL033403-3|CAI42105.1| 428|Homo sapiens MCF.2 cell line derived transforming sequence protein. Length = 428 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 86 DDFQMYAKYCQNKPRSETIWRKYSEC 111 >AL033403-2|CAI42104.1| 1070|Homo sapiens MCF.2 cell line derived transforming sequence protein. Length = 1070 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 728 DDFQMYAKYCQNKPRSETIWRKYSEC 753 >AB209679-1|BAD92916.1| 435|Homo sapiens MCF.2 cell line derived transforming sequence variant protein. Length = 435 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 93 DDFQMYAKYCQNKPRSETIWRKYSEC 118 >AB085902-1|BAC41201.1| 941|Homo sapiens DBL proto-oncogene splicing variant 2 protein. Length = 941 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 599 DDFQMYAKYCQNKPRSETIWRKYSEC 624 >AB085901-1|BAC41200.1| 860|Homo sapiens DBL proto-oncogene splicing variant 1 protein. Length = 860 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 DPQQSLREECSQKPDAQNMWAKYQEC 190 D Q + C KP ++ +W KY EC Sbjct: 583 DDFQMYAKYCQNKPRSETIWRKYSEC 608 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,391,226 Number of Sequences: 237096 Number of extensions: 947484 Number of successful extensions: 10769 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 10755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10769 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4099895856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -