BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0380 (775 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 2.3 SPBC691.03c |apl3||AP-2 adaptor complex subunit Alp3 |Schizosacc... 26 6.9 >SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 106 Score = 27.5 bits (58), Expect = 2.3 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 152 NNYIF-KHTKTMTAQHVYSMYMYVGIPIPIIHTNC-CTFSKISARLFGTTFLNVVLLEF 322 ++++F K MT+QH++ + I+H C +F +S + T L V L+F Sbjct: 33 HSFMFVKSLHLMTSQHIFKCLSSCNYALSILHNICLASFLYLSKCYYHTHILTSVRLDF 91 >SPBC691.03c |apl3||AP-2 adaptor complex subunit Alp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 878 Score = 25.8 bits (54), Expect = 6.9 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 176 KTMTAQHVYSM-YMYVGIPIPIIHTNCC 256 K + +H YS Y+Y +P P + N C Sbjct: 228 KNIVFEHGYSSDYLYYSVPCPWLQVNLC 255 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,596,347 Number of Sequences: 5004 Number of extensions: 47414 Number of successful extensions: 121 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 373338084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -