BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0380 (775 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0895 + 7506460-7507929 28 7.2 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 28 9.5 >07_01_0895 + 7506460-7507929 Length = 489 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -2 Query: 711 KSYIIHPKSITLFIYI*SRPKRGTFIYVF---KWSR 613 ++Y +HPK T F+ + GTF Y KW+R Sbjct: 309 EAYAVHPKGRTFFVSVRQVDDEGTFSYSVESGKWTR 344 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +1 Query: 265 QNICSLV--WNYISECSSSRIYVCIF 336 QNI SL W+ + CSS Y CIF Sbjct: 347 QNIASLASRWHALVTCSSDSTYCCIF 372 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,569,432 Number of Sequences: 37544 Number of extensions: 233086 Number of successful extensions: 416 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2068401984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -