BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0377 (764 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 30 0.021 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 1.3 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 1.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 24 1.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 4.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 7.2 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 9.5 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 9.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.5 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 9.5 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 9.5 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 30.3 bits (65), Expect = 0.021 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 10 GGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHC 141 GG+ P +AG+ G ICGA++++ +TAAHC Sbjct: 163 GGTNTGINEFPMMAGIKRTYEPGM--ICGATIISKRYVLTAAHC 204 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 255 NMNNLNNDVAIINHNHVGFNNNIQRI 332 N NN NN+ N+ + +NNN +++ Sbjct: 326 NYNNYNNNYNNYNNYNNNYNNNYKKL 351 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 210 AGEDVSCTKSEGELTSLGVPG 148 AG D+S + GE LGVPG Sbjct: 184 AGGDISSFITNGEWDLLGVPG 204 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.8 bits (49), Expect = 1.8 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +3 Query: 48 CWTCDRTHEWQNFH 89 CW CD+ E++ H Sbjct: 467 CWVCDQCEEYEYVH 480 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = +3 Query: 12 WFCRQRWCSPPSCWTCDRTHE 74 W CR ++ S W D H+ Sbjct: 926 WSCRCKFLQELSSWVSDNAHK 946 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 7.2 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = +3 Query: 48 CWTCDRTHEWQ 80 CW CD+ E++ Sbjct: 557 CWVCDQCEEYE 567 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 252 LNMNNLNNDVAIINHNHVGFNNN 320 L+ N ++N+ N+N+ +NNN Sbjct: 84 LSNNTIHNNNYKYNYNNNNYNNN 106 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 252 LNMNNLNNDVAIINHNHVGFNNN 320 L+ N ++N+ N+N+ +NNN Sbjct: 84 LSNNTIHNNNYKYNYNNNNYNNN 106 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 605 GITSFGSDRGCQRG 646 GITS GSD G G Sbjct: 1065 GITSSGSDSGSSNG 1078 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 255 NMNNLNNDVAIINHNHVGFNNN 320 N NN NN+ A N N G +NN Sbjct: 245 NNNNNNNNGANDNGNGNGASNN 266 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 9.5 Identities = 5/10 (50%), Positives = 6/10 (60%) Frame = +3 Query: 3 ARGWFCRQRW 32 + GW C RW Sbjct: 375 SNGWICEHRW 384 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,838 Number of Sequences: 438 Number of extensions: 2614 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -