BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0374 (718 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation facto... 76 3e-16 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 1.9 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 22 4.3 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 22 4.3 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 5.7 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 7.6 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 21 7.6 >AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation factor 1-alpha protein. Length = 56 Score = 76.2 bits (179), Expect = 3e-16 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 256 RVETGVLKPGTIVVFAPANITTEVKSVNMHHETLQEAVPG 375 RVETGVLKPG +VVFAPANITTEVKSV MHHE L EAVPG Sbjct: 17 RVETGVLKPGMVVVFAPANITTEVKSVEMHHEALPEAVPG 56 Score = 34.7 bits (76), Expect = 8e-04 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 209 LQDVYKIGGIGTMPVAELK 265 LQDVYKIGGIGT+PV ++ Sbjct: 1 LQDVYKIGGIGTVPVGRVE 19 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 321 SSDVGGGKDNNGTWFQHTSF 262 ++ V GG +NNGT H+ F Sbjct: 182 AAQVSGGNNNNGTPGGHSGF 201 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 259 LCDGHGTNTTDFVYVLQ 209 LC GT TT F+ +LQ Sbjct: 356 LCGIFGTTTTYFIVILQ 372 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 259 LCDGHGTNTTDFVYVLQ 209 LC GT TT F+ +LQ Sbjct: 356 LCGIFGTTTTYFIVILQ 372 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 253 RRVETGVLKPGTIVVFAPANITTEVKS 333 R ETG ++PG I P T EV++ Sbjct: 93 RYQETGSIRPGVIGGSKPRVATPEVEN 119 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 363 FLESFVVHIHRLDFSSDVG 307 FLE + H R FSS VG Sbjct: 68 FLEMTLAHHCRFKFSSSVG 86 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +1 Query: 493 IVLNHLVKSQTVTHQ 537 I+++HLV Q++ HQ Sbjct: 257 IMMHHLVNPQSLNHQ 271 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,523 Number of Sequences: 336 Number of extensions: 4541 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -