BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0371 (555 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49660.1 68418.m06147 leucine-rich repeat transmembrane prote... 27 8.4 >At5g49660.1 68418.m06147 leucine-rich repeat transmembrane protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 966 Score = 27.1 bits (57), Expect = 8.4 Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = -2 Query: 236 IYESNSILLKSEYSY--LQYH*CPIDFSVISGLLSSSNKYNNRNDGKAMKINVKAGIIVQ 63 + E + L S +SY +H D I L N + G ++ +K+G +V Sbjct: 623 VIEQDETLASSFFSYDVKSFHRISFDQREILESLVDKNIVGHGGSGTVYRVELKSGEVVA 682 Query: 62 INSIICPSNKN 30 + + SNK+ Sbjct: 683 VKKLWSQSNKD 693 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,746,583 Number of Sequences: 28952 Number of extensions: 146085 Number of successful extensions: 229 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 229 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1053014392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -