Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0371
         (555 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g49660.1 68418.m06147 leucine-rich repeat transmembrane prote...    27   8.4  

>At5g49660.1 68418.m06147 leucine-rich repeat transmembrane protein
           kinase, putative contains leucine rich repeat (LRR)
           domains, Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 966

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 2/71 (2%)
 Frame = -2

Query: 236 IYESNSILLKSEYSY--LQYH*CPIDFSVISGLLSSSNKYNNRNDGKAMKINVKAGIIVQ 63
           + E +  L  S +SY    +H    D   I   L   N   +   G   ++ +K+G +V 
Sbjct: 623 VIEQDETLASSFFSYDVKSFHRISFDQREILESLVDKNIVGHGGSGTVYRVELKSGEVVA 682

Query: 62  INSIICPSNKN 30
           +  +   SNK+
Sbjct: 683 VKKLWSQSNKD 693


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,746,583
Number of Sequences: 28952
Number of extensions: 146085
Number of successful extensions: 229
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 228
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 229
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1053014392
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)