BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0366 (724 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 23 2.5 DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 23 2.5 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 4.4 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 4.4 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 22 5.8 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 24 LQNEIANCPRTHWSGGRRI 80 LQNE A C H G R++ Sbjct: 67 LQNECAKCNEKHKEGVRKV 85 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 24 LQNEIANCPRTHWSGGRRI 80 LQNE A C H G R++ Sbjct: 68 LQNECAKCNEKHKEGVRKV 86 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 62 ERRPPHQSNPSKSRISQYRNTKASTLECTSSP 157 ++ PPHQ P + + +Q + +T SP Sbjct: 200 QQGPPHQQPPIQQQPNQGQQPPGNTAAALPSP 231 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 62 ERRPPHQSNPSKSRISQYRNTKASTLECTSSP 157 ++ PPHQ P + + +Q + +T SP Sbjct: 202 QQGPPHQQPPIQQQPNQGQQPPGNTAAALPSP 233 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 21 NLQNEIANCPRTHWSGGRRINQTRPNRGYPNTEIRKHR 134 +L + ANCP + + ++ RP+ G ++RK R Sbjct: 88 HLGSYAANCPPSPKDDEKCLSLERPSGGGKGKKMRKPR 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,337 Number of Sequences: 336 Number of extensions: 2885 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -