BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0365 (631 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12097| Best HMM Match : Birna_VP5 (HMM E-Value=4.6) 31 1.0 SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) 30 1.8 >SB_12097| Best HMM Match : Birna_VP5 (HMM E-Value=4.6) Length = 383 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = -3 Query: 467 GASGSHSYDSNESNEEFHF*LKKEKIY*NIWLLRTHINSFYCLGGRSPRLTAH 309 G + SH Y N H L + ++ W LRT +S G +SP L+ H Sbjct: 166 GTTPSHGYQVNHGLYALHNTLTRTRVPSQPWSLRTVQHSHSHTGTKSPMLSTH 218 >SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) Length = 791 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = -2 Query: 366 YPYQFFLLLRWSFP---AAHGPLDVNWLPEPIDIYNVNAATNLP*GM 235 YP+ + FP A H PLDV+ + P D +N TN P M Sbjct: 555 YPFPEMIYPEMMFPRMDAMHSPLDVSHVRNPFDPHNPCCITNDPLAM 601 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,513,566 Number of Sequences: 59808 Number of extensions: 264848 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -