BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0365 (631 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56470.1 68416.m06280 F-box family protein similar to F-box p... 28 4.4 At3g51820.1 68416.m05683 chlorophyll synthetase, putative identi... 27 7.8 >At3g56470.1 68416.m06280 F-box family protein similar to F-box protein family, AtFBX7 (GI:20197899) [Arabidopsis thaliana] Length = 367 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -3 Query: 512 RQNGLQLSISLSGFDGASGSHSYDSNESNEEFHF*LKKEKIY*NIWLL 369 +Q+G+ + LS F G + Y + E F KK+ Y NIW++ Sbjct: 305 KQSGIWNCLCLSVFHGFKRTCIYYKVDEESEVCFKWKKQNPYENIWIM 352 >At3g51820.1 68416.m05683 chlorophyll synthetase, putative identical to gi:972938 putative chlorophyll synthetase from Arabidopsis thaliana Length = 387 Score = 27.5 bits (58), Expect = 7.8 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -1 Query: 547 TGGWVCAGAVDSVRMACSSALVSAG 473 T W+C GA+D +++ + L+++G Sbjct: 308 TAKWICVGAIDITQLSVAGYLLASG 332 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,892,435 Number of Sequences: 28952 Number of extensions: 192605 Number of successful extensions: 388 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 388 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -