SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0362
         (700 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor 1-a...    22   4.9  
AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor 1-a...    22   4.9  
AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...    22   4.9  
AY155490-1|AAO12861.1|  342|Apis mellifera Ammar1 transposase pr...    21   8.5  

>EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor
           1-alpha protein.
          Length = 172

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -3

Query: 275 AVAHVHVSGWH 243
           AVA V +SGWH
Sbjct: 114 AVAFVPISGWH 124


>AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor
           1-alpha protein.
          Length = 274

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -3

Query: 275 AVAHVHVSGWH 243
           AVA V +SGWH
Sbjct: 130 AVAFVPISGWH 140


>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -3

Query: 275 AVAHVHVSGWH 243
           AVA V +SGWH
Sbjct: 187 AVAFVPISGWH 197


>AY155490-1|AAO12861.1|  342|Apis mellifera Ammar1 transposase
           protein.
          Length = 342

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 10/38 (26%), Positives = 19/38 (50%)
 Frame = +3

Query: 498 YEKACPTDSLVV*KDAQCT*YHSRWVLWDLSLEDRRRN 611
           ++K C        K+ QC  +  ++   D SL+D +R+
Sbjct: 26  HKKLCAVYGDEALKERQCQNWFDKFRSGDFSLKDEKRS 63


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 182,359
Number of Sequences: 438
Number of extensions: 4318
Number of successful extensions: 9
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -