BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0361 (601 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0189 + 1397068-1397241,1397713-1397804,1398456-1398546,139... 27 8.7 >12_01_0189 + 1397068-1397241,1397713-1397804,1398456-1398546, 1398931-1399052,1399142-1399289,1399596-1399665, 1400465-1400517,1400678-1400822,1401308-1401426, 1401480-1401527,1401528-1401599,1401902-1402024, 1402025-1402131,1402437-1402547,1402585-1402777, 1402959-1403129,1403548-1403673 Length = 654 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 412 SSLIDRK*LLTNKTKIIFNYFIRILFYYFTS 504 SSL R+ + + K++ NY+ ILF F S Sbjct: 393 SSLASRRPRILDTQKVLINYYAMILFQVFVS 423 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,713,432 Number of Sequences: 37544 Number of extensions: 148149 Number of successful extensions: 218 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -