BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0361 (601 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U70850-3|AAB09122.3| 596|Caenorhabditis elegans Zinc finger plu... 29 2.5 AY289599-1|AAP43944.1| 596|Caenorhabditis elegans ZAG-1 protein. 29 2.5 AY224511-1|AAP37457.1| 596|Caenorhabditis elegans ZAG-1 protein. 29 2.5 Z81147-10|CAB03533.3| 671|Caenorhabditis elegans Hypothetical p... 28 5.9 Z81147-4|CAB03529.1| 578|Caenorhabditis elegans Hypothetical pr... 27 7.7 CU457741-7|CAM36348.1| 710|Caenorhabditis elegans Hypothetical ... 27 7.7 >U70850-3|AAB09122.3| 596|Caenorhabditis elegans Zinc finger plus homeodomain, axonguidance protein 1 protein. Length = 596 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 323 PSRITPFNPFQIPLLNTIIL 382 PS +TPFNP+Q+ + I+L Sbjct: 82 PSMVTPFNPYQLMMYRNIML 101 >AY289599-1|AAP43944.1| 596|Caenorhabditis elegans ZAG-1 protein. Length = 596 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 323 PSRITPFNPFQIPLLNTIIL 382 PS +TPFNP+Q+ + I+L Sbjct: 82 PSMVTPFNPYQLMMYRNIML 101 >AY224511-1|AAP37457.1| 596|Caenorhabditis elegans ZAG-1 protein. Length = 596 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 323 PSRITPFNPFQIPLLNTIIL 382 PS +TPFNP+Q+ + I+L Sbjct: 82 PSMVTPFNPYQLMMYRNIML 101 >Z81147-10|CAB03533.3| 671|Caenorhabditis elegans Hypothetical protein T09E11.4 protein. Length = 671 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 418 LIDRK*LLTNKTKIIFNYFIRILFYYFTSI 507 LID + LL NKT F YF F YFT++ Sbjct: 619 LIDYEPLLFNKTTNRFEYFDSRGFLYFTAV 648 >Z81147-4|CAB03529.1| 578|Caenorhabditis elegans Hypothetical protein T09E11.5 protein. Length = 578 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 418 LIDRK*LLTNKTKIIFNYFIRILFYYFTSI*YIEA 522 LID + LL NKT F +F F YFT I ++ A Sbjct: 526 LIDYEPLLFNKTSNRFEFFDSRGFLYFTVINHLSA 560 >CU457741-7|CAM36348.1| 710|Caenorhabditis elegans Hypothetical protein C42C1.7 protein. Length = 710 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 418 LIDRK*LLTNKTKIIFNYFIRILFYYFTSI*YIEA 522 +ID + LL NKT F +F F YFT + ++ A Sbjct: 658 MIDYEPLLFNKTSNRFEFFDNRGFLYFTGVNHLSA 692 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,984,956 Number of Sequences: 27780 Number of extensions: 152340 Number of successful extensions: 284 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -