BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0360 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 5.1 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 23 6.8 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 23 9.0 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 23 9.0 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 23 9.0 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 23 9.0 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 23 9.0 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 5.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -2 Query: 518 EIINYIYKMSISSCSFKSKVMIFRKVII*MSNIA 417 ++ NY+ + S F K+ +FR V + +S++A Sbjct: 283 QLFNYLVQYEKYSPLFVIKISLFRTVFLRLSSLA 316 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 23.0 bits (47), Expect = 6.8 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 264 ILLGFYFTILQAYEYIEASFTIADRIYGSTFF 359 +++ YFT+L + SF + +R TFF Sbjct: 58 LIINGYFTVLYFNLVLRTSFLVINRRKFETFF 89 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.6 bits (46), Expect = 9.0 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 360 IATGFH-GIHVIIGTLFLLICY 422 IA GF +IIG L +L CY Sbjct: 156 IAAGFTIAASIIIGGLLMLFCY 177 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.6 bits (46), Expect = 9.0 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 360 IATGFH-GIHVIIGTLFLLICY 422 IA GF +IIG L +L CY Sbjct: 156 IAAGFTIAASIIIGGLLMLFCY 177 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.6 bits (46), Expect = 9.0 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 360 IATGFH-GIHVIIGTLFLLICY 422 IA GF +IIG L +L CY Sbjct: 156 IAAGFTIAASIIIGGLLMLFCY 177 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.6 bits (46), Expect = 9.0 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 360 IATGFH-GIHVIIGTLFLLICY 422 IA GF +IIG L +L CY Sbjct: 156 IAAGFTIAASIIIGGLLMLFCY 177 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 22.6 bits (46), Expect = 9.0 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 360 IATGFH-GIHVIIGTLFLLICY 422 IA GF +IIG L +L CY Sbjct: 732 IAAGFTIAASIIIGGLLMLFCY 753 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,450 Number of Sequences: 2352 Number of extensions: 7853 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -