BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0360 (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identica... 122 2e-28 At5g19130.2 68418.m02277 GPI transamidase component family prote... 29 2.8 At5g19130.1 68418.m02276 GPI transamidase component family prote... 29 2.8 At2g06090.1 68415.m00668 self-incompatibility protein-related si... 29 2.8 >At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identical to cytochrome c oxidase subunit 3 (GI:15215914) [Arabidopsis thaliana]; similar to Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Swiss-Prot:P92514) [Arabidopsis thaliana] Length = 265 Score = 122 bits (294), Expect = 2e-28 Identities = 59/92 (64%), Positives = 67/92 (72%) Frame = +3 Query: 261 TILLGFYFTILQAYEYIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRHLNN 440 T+LL FT Q EY +A FTI+D IYGSTFF+ATGFHG HVIIGTLFL+IC IR Sbjct: 169 TVLLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLG 228 Query: 441 HFSKNHHFGFEAAA*Y*HFVDVVDYFFTFLFI 536 H +K HH GFEAAA Y HFVDVV + F F+ I Sbjct: 229 HLTKEHHVGFEAAAWYWHFVDVV-WLFLFVSI 259 Score = 53.6 bits (123), Expect = 9e-08 Identities = 25/50 (50%), Positives = 33/50 (66%) Frame = +1 Query: 73 HRRLSPNIEIGRI*PPSRITPFNPFQIPLLNTIILIRSGVTVT*AHHSLI 222 H L+P +EIG I PP I +P++IP LNT IL SG VT AHH+++ Sbjct: 106 HSSLAPAVEIGGIWPPKGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAIL 155 >At5g19130.2 68418.m02277 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 696 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 291 LQAYEYIEASFTIADRIYGSTFFIATGFHG 380 + A +Y+E S T+A +Y I TG HG Sbjct: 352 IPAADYLEGSATLASSLYSQALGIPTGPHG 381 >At5g19130.1 68418.m02276 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 699 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 291 LQAYEYIEASFTIADRIYGSTFFIATGFHG 380 + A +Y+E S T+A +Y I TG HG Sbjct: 355 IPAADYLEGSATLASSLYSQALGIPTGPHG 384 >At2g06090.1 68415.m00668 self-incompatibility protein-related similar to S1 self-incompatibility protein [Papaver rhoeas] GI:452430 Length = 135 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 270 LGFYFTILQAYEYIEASFTIADRIYGSTFFIATGFHGI 383 LG + T+ ++YEY +F D ++G T F T HG+ Sbjct: 53 LGIH-TVARSYEY---NFKFEDSVFGRTEFFCTLMHGV 86 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,973,175 Number of Sequences: 28952 Number of extensions: 158462 Number of successful extensions: 258 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 258 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -