BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0359 (701 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY113484-1|AAM29489.1| 558|Drosophila melanogaster RE45347p pro... 30 2.6 AE014297-4260|AAF56810.2| 558|Drosophila melanogaster CG10000-P... 30 2.6 >AY113484-1|AAM29489.1| 558|Drosophila melanogaster RE45347p protein. Length = 558 Score = 30.3 bits (65), Expect = 2.6 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 5/77 (6%) Frame = -1 Query: 557 HAGGTYPCGLRRRPATIITNKLCQFDYTMIFLRR-----GSEHVNFIRKTDVSSRVFNTS 393 HAGG Y CG R II +CQ + +IF+R +E ++F+ +++ S + Sbjct: 2 HAGGKY-CGPRHCSFYIIAFLICQLFFLVIFIRNDDASSANELLSFMNESEESDHLDWRV 60 Query: 392 MESLTLRPRGLEDVYGF 342 S T P ED Y + Sbjct: 61 FISHT--PETSEDFYQY 75 >AE014297-4260|AAF56810.2| 558|Drosophila melanogaster CG10000-PA protein. Length = 558 Score = 30.3 bits (65), Expect = 2.6 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 5/77 (6%) Frame = -1 Query: 557 HAGGTYPCGLRRRPATIITNKLCQFDYTMIFLRR-----GSEHVNFIRKTDVSSRVFNTS 393 HAGG Y CG R II +CQ + +IF+R +E ++F+ +++ S + Sbjct: 2 HAGGKY-CGPRHCSFYIIAFLICQLFFLVIFIRNDDASSANELLSFMNESEESDHLDWRV 60 Query: 392 MESLTLRPRGLEDVYGF 342 S T P ED Y + Sbjct: 61 FISHT--PETSEDFYQY 75 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,207,366 Number of Sequences: 53049 Number of extensions: 583827 Number of successful extensions: 1064 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1064 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3087795150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -