BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0359 (701 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.5 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 8.6 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 8.6 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 8.6 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.5 Identities = 15/59 (25%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Frame = -2 Query: 226 KRSNVNLKIGFKKKNTLLTKNQELLKF--YLPK*YPTIIIIN*KKKC--VRVLVYTRKK 62 +R+ + L FK+K NQ++ KF YL + T+ I+ + + +L + ++K Sbjct: 292 ERNRLQLLESFKRKVNFYPNNQDIEKFLNYLKRGGKTLTSISVESNTMFINILKFLKQK 350 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 170 KKSRTIEILPSKIISYYYNNKLEKKM 93 +KS+ +I+ S +Y YNN KK+ Sbjct: 74 EKSKEHKIISSLSNNYNYNNNNYKKL 99 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 170 KKSRTIEILPSKIISYYYNNKLEKKM 93 +KS+ +I+ S +Y YNN KK+ Sbjct: 74 EKSKEHKIISSLSNNYNYNNNNYKKL 99 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 170 KKSRTIEILPSKIISYYYNNKLEKKM 93 +KS+ +I+ S +Y YNN KK+ Sbjct: 74 EKSKEHKIISSLSNNYNYNNNNYKKL 99 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,273 Number of Sequences: 438 Number of extensions: 4044 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -