BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0356 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.4 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 22 4.2 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 22 4.2 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 22 4.2 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 22 4.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 5.6 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 9.7 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -3 Query: 223 SQVQQDGGEHQRWRQNHPQSWYRRSQRL 140 S V D G + + H W+RR RL Sbjct: 2 SGVVGDAGRASKGQDKHMVHWFRRGLRL 29 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 400 HLHGSYNMNNLNNDVAIINHNH 465 H H +YN N L+N N+ H Sbjct: 65 HNHQNYNSNVLSNGYGYGNYYH 86 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 400 HLHGSYNMNNLNNDVAIINHNH 465 H H +YN N L+N N+ H Sbjct: 65 HNHQNYNSNVLSNGYGYGNYYH 86 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 400 HLHGSYNMNNLNNDVAIINHNH 465 H H +YN N L+N N+ H Sbjct: 65 HNHQNYNSNVLSNGYGYGNYYH 86 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 400 HLHGSYNMNNLNNDVAIINHNH 465 H H +YN N L+N N+ H Sbjct: 65 HNHQNYNSNVLSNGYGYGNYYH 86 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +2 Query: 575 GSQQPTKTPSEPPGHHNAVCARTYGNSVIIGS 670 G+ P+ TPS P + TY + ++ S Sbjct: 73 GAPSPSSTPSSLPTQRTSTSNPTYSSRSVMTS 104 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 21.0 bits (42), Expect = 9.7 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -1 Query: 243 SAIRECDHKSSKMGVSTSVGGRTTHNPGTVEVSGFLGASKTLSPGDTDLVVVVKFDGL 70 SA++E K+ + V SVGG T V + K ++ + +DGL Sbjct: 86 SALKE---KNPNLKVMLSVGGATASPDSFVAAANDPEKMKNMTSSAIEFFETYNYDGL 140 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,086 Number of Sequences: 336 Number of extensions: 2475 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -