BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0352 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 72 6e-15 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 72 6e-15 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 72 6e-15 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 71 8e-15 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 48 9e-08 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 37 2e-04 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 2.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 3.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 3.9 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 6.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 6.7 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 6.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 6.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 6.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 6.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 6.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 6.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 6.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 6.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 6.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 6.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 6.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 6.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 6.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 6.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 6.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 6.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 6.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 6.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 6.7 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 6.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 6.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 6.7 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 6.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 6.7 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 71.7 bits (168), Expect = 6e-15 Identities = 36/85 (42%), Positives = 55/85 (64%), Gaps = 7/85 (8%) Frame = +1 Query: 256 VAHVEYQTEQRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGVMP-------QTR 414 +A +++T + + D PGH D+IKNMITGT+Q D A+L+VAA G QTR Sbjct: 2 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 61 Query: 415 EHLLLAKQIGIQHVVVFINKVDAAD 489 EH LLA +G++ ++V +NK+D+ + Sbjct: 62 EHALLAFTLGVKQLIVGVNKMDSTE 86 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 71.7 bits (168), Expect = 6e-15 Identities = 36/85 (42%), Positives = 55/85 (64%), Gaps = 7/85 (8%) Frame = +1 Query: 256 VAHVEYQTEQRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGVMP-------QTR 414 +A +++T + + D PGH D+IKNMITGT+Q D A+L+VAA G QTR Sbjct: 18 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 77 Query: 415 EHLLLAKQIGIQHVVVFINKVDAAD 489 EH LLA +G++ ++V +NK+D+ + Sbjct: 78 EHALLAFTLGVKQLIVGVNKMDSTE 102 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 71.7 bits (168), Expect = 6e-15 Identities = 36/85 (42%), Positives = 55/85 (64%), Gaps = 7/85 (8%) Frame = +1 Query: 256 VAHVEYQTEQRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGVMP-------QTR 414 +A +++T + + D PGH D+IKNMITGT+Q D A+L+VAA G QTR Sbjct: 75 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 134 Query: 415 EHLLLAKQIGIQHVVVFINKVDAAD 489 EH LLA +G++ ++V +NK+D+ + Sbjct: 135 EHALLAFTLGVKQLIVGVNKMDSTE 159 Score = 31.9 bits (69), Expect = 0.006 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +2 Query: 86 RTKPHCNVGTIGHVDHGKTTLTAAITKVLSDLNLAQKKGYADIDNAPEEKARG-ITIMWL 262 + K H N+ IGHVD GK+T T + ++ K+ + +E +G W+ Sbjct: 3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGID---KRTIEKFEKEAQEMGKGSFKYAWV 59 Query: 263 MSNTKPNR 286 + K R Sbjct: 60 LDKLKAER 67 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 71.3 bits (167), Expect = 8e-15 Identities = 37/85 (43%), Positives = 54/85 (63%), Gaps = 7/85 (8%) Frame = +1 Query: 256 VAHVEYQTEQRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGVMP-------QTR 414 +A +++T + + D PGH D+IKNMITGT+Q D A+L+VAA G QTR Sbjct: 75 IALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGIGEFEAGISKNGQTR 134 Query: 415 EHLLLAKQIGIQHVVVFINKVDAAD 489 EH LLA +G++ ++V +NK+D D Sbjct: 135 EHALLAFTLGVKQLIVGVNKMDMTD 159 Score = 31.9 bits (69), Expect = 0.006 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +2 Query: 86 RTKPHCNVGTIGHVDHGKTTLTAAITKVLSDLNLAQKKGYADIDNAPEEKARG-ITIMWL 262 + K H N+ IGHVD GK+T T + ++ K+ + +E +G W+ Sbjct: 3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGID---KRTIEKFEKEAQEMGKGSFKYAWV 59 Query: 263 MSNTKPNR 286 + K R Sbjct: 60 LDKLKAER 67 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 48.0 bits (109), Expect = 9e-08 Identities = 25/68 (36%), Positives = 40/68 (58%) Frame = +1 Query: 304 DCPGHADYIKNMITGTAQMDGAILVVAATDGVMPQTREHLLLAKQIGIQHVVVFINKVDA 483 D PGHA +I G D +LVVAA DGV QT + + +AK + ++V INK+D Sbjct: 199 DTPGHAAFISMRHRGAHITDIVVLVVAADDGVKEQTLQSIEMAKDAKVP-IIVAINKIDK 257 Query: 484 ADEEMVEL 507 + +++++ Sbjct: 258 PNIDIIKV 265 Score = 31.1 bits (67), Expect = 0.011 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 92 KPHCNVGTIGHVDHGKTTLTAAI 160 K H V +GHVDHGKTTL A+ Sbjct: 143 KRHPIVTIMGHVDHGKTTLLDAL 165 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 36.7 bits (81), Expect = 2e-04 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +2 Query: 104 NVGTIGHVDHGKTTLTAAITKV--LSDLNLAQKKGYADIDNAPEEKARG 244 N+GTIGHV HGK+T+ AI+ V + N ++ +D E+ RG Sbjct: 44 NIGTIGHVAHGKSTIVKAISGVQTVRFKNELERNITIKLDTRAEDSTRG 92 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 333 EHDYRHSTNGWCYISSSC 386 E DY N W YI S C Sbjct: 298 ESDYYPDLNEWLYILSGC 315 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 3.9 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = +2 Query: 608 PEIWADAITKL 640 PE+W DA+T++ Sbjct: 277 PEVWIDAVTQI 287 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 3.9 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = +2 Query: 608 PEIWADAITKL 640 PE+W DA+T++ Sbjct: 330 PEVWIDAVTQI 340 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 202 SSNSLRSRTHGFQHTS 217 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRNRTHDFQHTS 228 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 202 SSNSLRSRTHGFQHTS 217 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 202 SSNSLRSRTHGFQHTS 217 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 202 SSNSLRNRTHGFQHTS 217 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRNRTHGFQHTS 228 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRNRTHGFQHTS 228 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 202 SSNSLRNRTHGFQHTS 217 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRNRTHGFQHTS 228 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 202 SSNSLRNRTHGFQHTS 217 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 218 SSNSLRNRTHGFQHTS 233 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRNRTHGFQHTS 228 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHGFQHTS 228 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRSRTHDFQHTS 228 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 630 SLNFLKKWTHSFQHLS 677 S N L+ TH FQH S Sbjct: 213 SSNSLRNRTHGFQHTS 228 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,609 Number of Sequences: 438 Number of extensions: 4143 Number of successful extensions: 43 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -